DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynepsilonL and Atp5e

DIOPT Version :9

Sequence 1:NP_001097736.1 Gene:ATPsynepsilonL / 326144 FlyBaseID:FBgn0051477 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_080259.1 Gene:Atp5e / 67126 MGIID:1855697 Length:52 Species:Mus musculus


Alignment Length:40 Identity:18/40 - (45%)
Similarity:29/40 - (72%) Gaps:0/40 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WRDLGITYIQYSNIAARVVREALRIELRADAAKRNISHVK 43
            ||..|::||::|.|.|:.||:||:.|.:|:|.|.:.|.:|
Mouse     5 WRQAGLSYIRFSQICAKAVRDALKTEFKANAEKTSGSSIK 44

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynepsilonLNP_001097736.1 ATP-synt_Eps 3..50 CDD:282481 18/40 (45%)
Atp5eNP_080259.1 ATP-synt_Eps 3..47 CDD:309668 18/40 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12235
eggNOG 1 0.900 - - E1_KOG3495
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I5493
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002155
OrthoInspector 1 1.000 - - otm42658
orthoMCL 1 0.900 - - OOG6_103560
Panther 1 1.100 - - O PTHR12448
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9948
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.