DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynepsilonL and sun

DIOPT Version :9

Sequence 1:NP_001097736.1 Gene:ATPsynepsilonL / 326144 FlyBaseID:FBgn0051477 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_524682.1 Gene:sun / 44046 FlyBaseID:FBgn0014391 Length:61 Species:Drosophila melanogaster


Alignment Length:64 Identity:44/64 - (68%)
Similarity:51/64 - (79%) Gaps:3/64 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAWRDLGITYIQYSNIAARVVREALRIELRADAAKRNISHVKFTPWVNGKPVPRKKVERESES 64
            |.|||..|||||||||||||::||:|:..||||||||:.||||||||.||||..|   :.:|||
  Fly     1 MTAWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANGKPAQR---QTQSES 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynepsilonLNP_001097736.1 ATP-synt_Eps 3..50 CDD:282481 35/46 (76%)
sunNP_524682.1 ATP-synt_Eps 2..50 CDD:398354 35/47 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466832
Domainoid 1 1.000 54 1.000 Domainoid score I4155
eggNOG 1 0.900 - - E1_KOG3495
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2556
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29538
OrthoDB 1 1.010 - - D136940at33392
OrthoFinder 1 1.000 - - FOG0002155
OrthoInspector 1 1.000 - - otm26378
orthoMCL 1 0.900 - - OOG6_103560
Panther 1 1.100 - - P PTHR12448
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6481
1211.810

Return to query results.
Submit another query.