powered by:
Protein Alignment ATPsynepsilonL and atp15
DIOPT Version :9
Sequence 1: | NP_001097736.1 |
Gene: | ATPsynepsilonL / 326144 |
FlyBaseID: | FBgn0051477 |
Length: | 64 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_596577.1 |
Gene: | atp15 / 2540229 |
PomBaseID: | SPBC31F10.15c |
Length: | 67 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 48 |
Identity: | 14/48 - (29%) |
Similarity: | 28/48 - (58%) |
Gaps: | 1/48 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 AWRDLGITYIQYSNIAARVVREALRIELRADAAKRNISHVKFTPWVNG 50
||:. ..:|.:|::|.::.||:||:.|::.:......:...:|.|.||
pombe 4 AWKK-NFSYSKYASICSQTVRQALKPEIKNEVKTHGDAEFLYTRWKNG 50
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3495 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002155 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_103560 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12448 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
6 | 5.860 |
|
Return to query results.
Submit another query.