DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynepsilonL and ZC262.5

DIOPT Version :9

Sequence 1:NP_001097736.1 Gene:ATPsynepsilonL / 326144 FlyBaseID:FBgn0051477 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_498839.1 Gene:ZC262.5 / 191132 WormBaseID:WBGene00022582 Length:54 Species:Caenorhabditis elegans


Alignment Length:57 Identity:22/57 - (38%)
Similarity:33/57 - (57%) Gaps:3/57 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAWRDLGITYIQYSNIAARVVREALRIELRADAAKRNISHVKFTPWVNGKPVPRKK 57
            |.|||..|:.|::||.|||:|||:..:   .....|:..:.:|.|.|.|||.|.:.:
 Worm     1 MVAWRAAGLNYVRYSQIAAQVVRQCTK---GGANVKKPQATLKTTAWENGKMVSKSQ 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynepsilonLNP_001097736.1 ATP-synt_Eps 3..50 CDD:282481 17/46 (37%)
ZC262.5NP_498839.1 ATP-synt_Eps 3..47 CDD:398354 17/46 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I8090
eggNOG 1 0.900 - - E1_KOG3495
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I4104
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628103at2759
OrthoFinder 1 1.000 - - FOG0002155
OrthoInspector 1 1.000 - - mtm4741
orthoMCL 1 0.900 - - OOG6_103560
Panther 1 1.100 - - O PTHR12448
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6481
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.