DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynepsilonL and LOC100361879

DIOPT Version :9

Sequence 1:NP_001097736.1 Gene:ATPsynepsilonL / 326144 FlyBaseID:FBgn0051477 Length:64 Species:Drosophila melanogaster
Sequence 2:XP_038948463.1 Gene:LOC100361879 / 100361879 RGDID:2319299 Length:52 Species:Rattus norvegicus


Alignment Length:40 Identity:17/40 - (42%)
Similarity:29/40 - (72%) Gaps:0/40 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WRDLGITYIQYSNIAARVVREALRIELRADAAKRNISHVK 43
            |:..|::||::|.|.|:.||:||:.|.:|:|.|.:.|.:|
  Rat     5 WQQAGLSYIRFSQICAKAVRDALKTEFKANAEKTSGSSIK 44

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynepsilonLNP_001097736.1 ATP-synt_Eps 3..50 CDD:282481 17/40 (43%)
LOC100361879XP_038948463.1 ATP-synt_Eps 3..50 CDD:398354 17/40 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I12055
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I5403
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002155
OrthoInspector 1 1.000 - - mtm8980
orthoMCL 1 0.900 - - OOG6_103560
Panther 1 1.100 - - O PTHR12448
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.