powered by:
Protein Alignment ATPsynepsilonL and LOC100361879
DIOPT Version :9
Sequence 1: | NP_001097736.1 |
Gene: | ATPsynepsilonL / 326144 |
FlyBaseID: | FBgn0051477 |
Length: | 64 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038948463.1 |
Gene: | LOC100361879 / 100361879 |
RGDID: | 2319299 |
Length: | 52 |
Species: | Rattus norvegicus |
Alignment Length: | 40 |
Identity: | 17/40 - (42%) |
Similarity: | 29/40 - (72%) |
Gaps: | 0/40 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 WRDLGITYIQYSNIAARVVREALRIELRADAAKRNISHVK 43
|:..|::||::|.|.|:.||:||:.|.:|:|.|.:.|.:|
Rat 5 WQQAGLSYIRFSQICAKAVRDALKTEFKANAEKTSGSSIK 44
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
43 |
1.000 |
Domainoid score |
I12055 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
43 |
1.000 |
Inparanoid score |
I5403 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002155 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm8980 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_103560 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12448 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
8 | 7.960 |
|
Return to query results.
Submit another query.