DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18A and AT1G07210

DIOPT Version :10

Sequence 1:NP_731252.1 Gene:mRpS18A / 326141 FlyBaseID:FBgn0051450 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_172201.1 Gene:AT1G07210 / 837232 AraportID:AT1G07210 Length:261 Species:Arabidopsis thaliana


Alignment Length:82 Identity:22/82 - (26%)
Similarity:40/82 - (48%) Gaps:4/82 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GVNVESPRAHLMLKSACQTKFCPECTLGLDIKHTD---VLILSQYVRSDGCMLPRRITGLCHRQQ 107
            |:| ..||....:::..|.....|.|....:|:.|   |..|:.::...|.::.|:.||:..:.|
plant   143 GMN-NFPRMQKQMQNPRQNNSKSEVTTEEVLKNADFRNVRFLANFITEAGIIIKRKQTGISAKAQ 206

  Fly   108 KKMGTLVTMAQKAGLMP 124
            :|:...:..|:..||||
plant   207 RKIAREIKTARAFGLMP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18ANP_731252.1 Ribosomal_S18 74..123 CDD:460054 12/51 (24%)
AT1G07210NP_172201.1 Ribosomal_S18 176..222 CDD:460054 11/45 (24%)

Return to query results.
Submit another query.