DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18A and AT1G07210

DIOPT Version :9

Sequence 1:NP_731252.1 Gene:mRpS18A / 326141 FlyBaseID:FBgn0051450 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_172201.1 Gene:AT1G07210 / 837232 AraportID:AT1G07210 Length:261 Species:Arabidopsis thaliana


Alignment Length:82 Identity:22/82 - (26%)
Similarity:40/82 - (48%) Gaps:4/82 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GVNVESPRAHLMLKSACQTKFCPECTLGLDIKHTD---VLILSQYVRSDGCMLPRRITGLCHRQQ 107
            |:| ..||....:::..|.....|.|....:|:.|   |..|:.::...|.::.|:.||:..:.|
plant   143 GMN-NFPRMQKQMQNPRQNNSKSEVTTEEVLKNADFRNVRFLANFITEAGIIIKRKQTGISAKAQ 206

  Fly   108 KKMGTLVTMAQKAGLMP 124
            :|:...:..|:..||||
plant   207 RKIAREIKTARAFGLMP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18ANP_731252.1 Ribosomal_S18 74..123 CDD:376453 12/51 (24%)
AT1G07210NP_172201.1 Ribosomal_S18 176..222 CDD:376453 11/45 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3162
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13479
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.