DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18A and Mrps18a

DIOPT Version :9

Sequence 1:NP_731252.1 Gene:mRpS18A / 326141 FlyBaseID:FBgn0051450 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_081044.1 Gene:Mrps18a / 68565 MGIID:1915815 Length:196 Species:Mus musculus


Alignment Length:155 Identity:55/155 - (35%)
Similarity:82/155 - (52%) Gaps:13/155 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFVLQLATRTVRSTIAQVRGVATT----MP-RQIKEIHEKQENSVKIFEGVNVESPRAHLMLKS 60
            |:.:..|.:...|...|.:.|.|.|    :| |.::|:.:.||....:.||...|:|:|  ....
Mouse     1 MAALRALVSGCGRQLQAFLAGPAATGWLWLPARGLREVVKIQEGKTTVIEGRITETPKA--TPDP 63

  Fly    61 ACQTKFCPECTLGLDIKHT--DVLILSQYVRSDGCMLPRRITGLCHRQQKKMGTLVTMAQKAGLM 123
            ...:..||.|...|..|:|  |||:|||::|..|.|||||:||||..:.:|:...|.||.:|||:
Mouse    64 PNPSGQCPICRWNLKHKYTYEDVLLLSQFIRPYGGMLPRRVTGLCREEHRKIEECVKMAHRAGLL 128

  Fly   124 PNLAPEWSKRD-PKKRFGWRKFNKY 147
            ||..|:..:.. ||.:   .|.|:|
Mouse   129 PNHRPQLPEGCLPKDK---PKLNRY 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18ANP_731252.1 Ribosomal_S18 74..123 CDD:376453 26/50 (52%)
Mrps18aNP_081044.1 Ribosomal_S18 78..128 CDD:279431 25/49 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841868
Domainoid 1 1.000 54 1.000 Domainoid score I11269
eggNOG 1 0.900 - - E1_KOG3162
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5262
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007099
OrthoInspector 1 1.000 - - oto93196
orthoMCL 1 0.900 - - OOG6_108113
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4152
SonicParanoid 1 1.000 - - X5184
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.680

Return to query results.
Submit another query.