DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18A and mrps18a

DIOPT Version :9

Sequence 1:NP_731252.1 Gene:mRpS18A / 326141 FlyBaseID:FBgn0051450 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001025285.1 Gene:mrps18a / 558080 ZFINID:ZDB-GENE-041210-109 Length:210 Species:Danio rerio


Alignment Length:172 Identity:56/172 - (32%)
Similarity:78/172 - (45%) Gaps:27/172 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLQLATRTVRST----------------IAQVRGVATTMPRQIKEIHEKQENSVKIFEG---VNV 49
            |||.|...|||.                .:|...:..|..|.::.:.||:|....|.||   ...
Zfish     6 VLQSARTAVRSAQNTLDKSTSLFQRIPGFSQHSFLGITPCRGLRHVAEKKEGKTTIIEGFIETTT 70

  Fly    50 ESPRAHLMLKSACQTKFCPECTLGLDIK--HTDVLILSQYVRSDGCMLPRRITGLCHRQQKKMGT 112
            |.|      :....|..||.....|..|  :||||:|||::||||.:|||||||||.::..|:..
Zfish    71 EQP------QPPNPTASCPIYRWNLQNKYNYTDVLLLSQFIRSDGGLLPRRITGLCAQEHNKIAI 129

  Fly   113 LVTMAQKAGLMPNLAPEWSKRDPKKRFGWRKFNKYFLESTIK 154
            .|.||.:|||:|:..|...:....|.......|:|....::|
Zfish   130 CVQMAHRAGLLPDHRPRLPEGHVPKPKPHPPLNRYLTRYSVK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18ANP_731252.1 Ribosomal_S18 74..123 CDD:376453 28/50 (56%)
mrps18aNP_001025285.1 Ribosomal_S18 92..140 CDD:279431 27/47 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586341
Domainoid 1 1.000 61 1.000 Domainoid score I10499
eggNOG 1 0.900 - - E1_KOG3162
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5275
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619493at2759
OrthoFinder 1 1.000 - - FOG0007099
OrthoInspector 1 1.000 - - oto38710
orthoMCL 1 0.900 - - OOG6_108113
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4152
SonicParanoid 1 1.000 - - X5184
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.690

Return to query results.
Submit another query.