DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18A and MRPS18A

DIOPT Version :9

Sequence 1:NP_731252.1 Gene:mRpS18A / 326141 FlyBaseID:FBgn0051450 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_006715197.1 Gene:MRPS18A / 55168 HGNCID:14515 Length:270 Species:Homo sapiens


Alignment Length:140 Identity:48/140 - (34%)
Similarity:63/140 - (45%) Gaps:35/140 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTVRSTIAQVRGVATT----MP-RQIKEIHEKQENSVKIFEG---------VNVESPRAHLMLKS 60
            |.:|..:|   |.|.|    :| |..:|:.|.||....|.||         .|..:|...     
Human    13 RLLRGLLA---GPAATSWSRLPARGFREVVETQEGKTTIIEGRITATPKESPNPPNPSGQ----- 69

  Fly    61 ACQTKFCPECTLGLDIKHT--DVLILSQYVRSDGCMLPRRITGLCHRQQKKMGTLVTMAQKAGLM 123
                  ||.|...|..|:.  |||:|||::|..|.||||:|||||..:.:|:...|.||.:||..
Human    70 ------CPICRWNLKHKYNYDDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGRR 128

  Fly   124 PNLAPEWSKR 133
            |     |..|
Human   129 P-----WGPR 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18ANP_731252.1 Ribosomal_S18 74..123 CDD:376453 25/50 (50%)
MRPS18AXP_006715197.1 Ribosomal_S18 78..126 CDD:279431 22/47 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151763
Domainoid 1 1.000 54 1.000 Domainoid score I11299
eggNOG 1 0.900 - - E1_KOG3162
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5324
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619493at2759
OrthoFinder 1 1.000 - - FOG0007099
OrthoInspector 1 1.000 - - oto89626
orthoMCL 1 0.900 - - OOG6_108113
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4152
SonicParanoid 1 1.000 - - X5184
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.690

Return to query results.
Submit another query.