DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18A and MRPS18C

DIOPT Version :9

Sequence 1:NP_731252.1 Gene:mRpS18A / 326141 FlyBaseID:FBgn0051450 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_057151.1 Gene:MRPS18C / 51023 HGNCID:16633 Length:142 Species:Homo sapiens


Alignment Length:93 Identity:31/93 - (33%)
Similarity:48/93 - (51%) Gaps:13/93 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VNVESPRAHLMLKSACQTKFCPECTLGLDIKHTDVLILSQYVRS-DGCMLPRRITGLCHRQQKKM 110
            :::|:|....:.|       |..|  |..:.:.:|.:|||:|.. .||:..|.|||||.::||::
Human    52 ISMENPYKEPLKK-------CILC--GKHVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEI 107

  Fly   111 GTLVTMAQKAGLMP--NLAPEWSKRDPK 136
            ...:..||..|.||  ...|.:.| |||
Human   108 TKAIKRAQIMGFMPVTYKDPAYLK-DPK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18ANP_731252.1 Ribosomal_S18 74..123 CDD:376453 18/49 (37%)
MRPS18CNP_057151.1 Ribosomal_S18 70..120 CDD:395861 18/49 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3162
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13479
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.