DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18A and mRpS18B

DIOPT Version :10

Sequence 1:NP_731252.1 Gene:mRpS18A / 326141 FlyBaseID:FBgn0051450 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_523606.1 Gene:mRpS18B / 35299 FlyBaseID:FBgn0032849 Length:204 Species:Drosophila melanogaster


Alignment Length:84 Identity:22/84 - (26%)
Similarity:40/84 - (47%) Gaps:7/84 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CPECT---LGLDIKHTDVLILSQYVR-SDGCMLPRRITGLCHRQQKKMGTLVTMAQKAGLMPNLA 127
            ||.|.   |.||.::|:  :|.|::. ..|.:|....||||.:...::...|..|:.:|.:....
  Fly   123 CPICRDEYLVLDYRNTE--LLEQFISPHSGDVLSYSKTGLCQKSHLRLMVAVQQARDSGYLTYDV 185

  Fly   128 PEWSKRDPKKRFGWRKFNK 146
            | :.:.|..:.:|..:..|
  Fly   186 P-FREYDYSEYYGQEQKQK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18ANP_731252.1 Ribosomal_S18 74..123 CDD:460054 14/49 (29%)
mRpS18BNP_523606.1 Ribosomal_S18 131..181 CDD:460054 15/51 (29%)

Return to query results.
Submit another query.