DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18A and Mrps18a

DIOPT Version :9

Sequence 1:NP_731252.1 Gene:mRpS18A / 326141 FlyBaseID:FBgn0051450 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_942051.1 Gene:Mrps18a / 301249 RGDID:735229 Length:196 Species:Rattus norvegicus


Alignment Length:146 Identity:55/146 - (37%)
Similarity:77/146 - (52%) Gaps:16/146 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTVRSTIAQVRGVATT----MP-RQIKEIHEKQENSVKIFEGVNVESPRAHLMLKSACQTKFCPE 69
            |.:::.:|   |.|.|    :| |.::|:.:.||....:.||...|||:|  .......:..||.
  Rat    13 RQLQTLLA---GPAATGWLWLPARGLREVVKIQEGKTTVIEGRVTESPKA--TPDPPNPSGQCPI 72

  Fly    70 CTLGLDIKHT--DVLILSQYVRSDGCMLPRRITGLCHRQQKKMGTLVTMAQKAGLMPNLAPEWSK 132
            |...|..|:.  |||:|||::|..|.||||||||||..:.:||...|.||.:|||.||..|...:
  Rat    73 CRWNLKHKYNYEDVLLLSQFIRPHGGMLPRRITGLCREEHRKMEECVKMAHRAGLFPNHRPRLPE 137

  Fly   133 R-DPKKRFGWRKFNKY 147
            . .||.:   .|.|:|
  Rat   138 GCSPKDK---PKLNRY 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18ANP_731252.1 Ribosomal_S18 74..123 CDD:376453 27/50 (54%)
Mrps18aNP_942051.1 Ribosomal_S18 78..127 CDD:279431 25/48 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345251
Domainoid 1 1.000 56 1.000 Domainoid score I10786
eggNOG 1 0.900 - - E1_KOG3162
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5168
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619493at2759
OrthoFinder 1 1.000 - - FOG0007099
OrthoInspector 1 1.000 - - oto96740
orthoMCL 1 0.900 - - OOG6_108113
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5184
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.660

Return to query results.
Submit another query.