powered by:
Protein Alignment mRpS18A and Mrps18c
DIOPT Version :9
Sequence 1: | NP_731252.1 |
Gene: | mRpS18A / 326141 |
FlyBaseID: | FBgn0051450 |
Length: | 155 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001099466.1 |
Gene: | Mrps18c / 289469 |
RGDID: | 1307997 |
Length: | 143 |
Species: | Rattus norvegicus |
Alignment Length: | 75 |
Identity: | 30/75 - (40%) |
Similarity: | 42/75 - (56%) |
Gaps: | 6/75 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 KFCPECTLGLDIKHTDVLILSQYVRS-DGCMLPRRITGLCHRQQKKMGTLVTMAQKAGLMP--NL 126
|.|..|...:|.| :|.:|||::.. .||:..|.|||||.::||::...:..|||.|.|| ..
Rat 64 KKCVLCEKRVDYK--NVQLLSQFISPFTGCIYGRHITGLCGKKQKEVTKAIKRAQKMGFMPVTYK 126
Fly 127 APEWSKRDPK 136
.|.:.| |||
Rat 127 DPAYLK-DPK 135
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3162 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR13479 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.