DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18A and mrps-18.C

DIOPT Version :9

Sequence 1:NP_731252.1 Gene:mRpS18A / 326141 FlyBaseID:FBgn0051450 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_495374.2 Gene:mrps-18.C / 188492 WormBaseID:WBGene00020499 Length:139 Species:Caenorhabditis elegans


Alignment Length:95 Identity:29/95 - (30%)
Similarity:53/95 - (55%) Gaps:7/95 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NVESPRAHLMLKSACQTK---FCPECTLGLDIKHTDVLILSQYVRS-DGCMLPRRITGLCHRQQK 108
            :|.|....::|::...||   .|..|:.|:::.:.:..:|.|:|.: .|.:..|.|||||...:|
 Worm    32 SVSSDDEPVILENNPYTKEPRKCLLCSTGVELDYKNSRLLQQFVSTFSGRVYDRHITGLCDENKK 96

  Fly   109 KMGTLVTMAQKAGLMPNLA--PEWSKRDPK 136
            |:...:..:::||.||...  |::: ||||
 Worm    97 KLIEAIAKSRRAGFMPIFVKDPKYT-RDPK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18ANP_731252.1 Ribosomal_S18 74..123 CDD:376453 14/49 (29%)
mrps-18.CNP_495374.2 Ribosomal_S18 61..111 CDD:279431 14/49 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3162
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.