DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18A and mrps-18A

DIOPT Version :9

Sequence 1:NP_731252.1 Gene:mRpS18A / 326141 FlyBaseID:FBgn0051450 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_498835.1 Gene:mrps-18A / 176176 WormBaseID:WBGene00022583 Length:183 Species:Caenorhabditis elegans


Alignment Length:93 Identity:36/93 - (38%)
Similarity:55/93 - (59%) Gaps:7/93 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 KFCPECTLGLDIKHT--DVLILSQYVRSDGCMLPRRITGLCHRQQKKMGTLVTMAQKAGLMPNLA 127
            :.|..||..:.||.|  |||||.|::|.||.:|||::||||.:||.:|...|..|..:||..:  
 Worm    66 ELCSLCTCNVPIKLTYKDVLILEQFMRDDGTVLPRQLTGLCKKQQLRMERCVMQAFWSGLFGD-- 128

  Fly   128 PEWSKRDPKKRFGWRKFNKYFLESTIKY 155
            ...::.|   |.|:::||:|:.:....|
 Worm   129 KYGTEAD---RAGYKRFNRYWKDDMSMY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18ANP_731252.1 Ribosomal_S18 74..123 CDD:376453 25/50 (50%)
mrps-18ANP_498835.1 Ribosomal_S18 77..125 CDD:279431 24/47 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162179
Domainoid 1 1.000 48 1.000 Domainoid score I8073
eggNOG 1 0.900 - - E1_KOG3162
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619493at2759
OrthoFinder 1 1.000 - - FOG0007099
OrthoInspector 1 1.000 - - oto17826
orthoMCL 1 0.900 - - OOG6_108113
Panther 1 1.100 - - LDO PTHR13479
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4152
SonicParanoid 1 1.000 - - X5184
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.