DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31445 and RNPEP

DIOPT Version :9

Sequence 1:NP_001263064.1 Gene:CG31445 / 326140 FlyBaseID:FBgn0051445 Length:927 Species:Drosophila melanogaster
Sequence 2:NP_064601.3 Gene:RNPEP / 6051 HGNCID:10078 Length:650 Species:Homo sapiens


Alignment Length:314 Identity:81/314 - (25%)
Similarity:133/314 - (42%) Gaps:50/314 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 TQFEPSSARKAFPCFDEPGFKASFVVTLGYHKQFNALSNMPVREIR-PHESLANYIWCEFQESVP 225
            ||.:....|..|||||.|..|..:...:.....|.|:.:....|.| |::..       ||...|
Human   168 TQGQAVLNRAFFPCFDTPAVKYKYSALIEVPDGFTAVMSASTWEKRGPNKFF-------FQMCQP 225

  Fly   226 MSTYLVAYSVNDFSFKPSTLPNGALFRTWARPNAIDQC---------DYAAE----FGPKVLQYY 277
            :.:||:|.::.|.    .:...|...|.||.|..||..         ::.|.    |||.|...|
Human   226 IPSYLIALAIGDL----VSAEVGPRSRVWAEPCLIDAAKEEYNGVIEEFLATGEKLFGPYVWGRY 286

  Fly   278 EEFFGIRYPLPKIDQMAVPDFSAGAMENWGLVKYRESTLLYSPTHSSLADKQDLANVIAHELAHQ 342
            :..|     :|       |.|..|.|||         ..|...|...||..:.||:||.||::|.
Human   287 DLLF-----MP-------PSFPFGGMEN---------PCLTFVTPCLLAGDRSLADVIIHEISHS 330

  Fly   343 WFGNLVTMKWWTDLWLNEGFATYVAGLGVQEIYPEWHSRDKGSLTALMTAFRLDSLVSSHPISR- 406
            |||||||...|.:.||||||..|........::...::..:.:....:....:|.....:|::: 
Human   331 WFGNLVTNANWGEFWLNEGFTMYAQRRISTILFGAAYTCLEAATGRALLRQHMDITGEENPLNKL 395

  Fly   407 --PIQMVTEIEESFDAISYQKGSA-VLRMMHLFMGEESFRTGLREYLKLYAYKN 457
              .|:...:.:::::...|:||.. |..:.||...::.|.:.|:.|:..:.:::
Human   396 RVKIEPGVDPDDTYNETPYEKGFCFVSYLAHLVGDQDQFDSFLKAYVHEFKFRS 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31445NP_001263064.1 Peptidase_M1 28..426 CDD:279741 73/280 (26%)
M1_APN_2 43..497 CDD:189008 81/314 (26%)
ERAP1_C 578..904 CDD:288671
RNPEPNP_064601.3 leuko_A4_hydro 24..634 CDD:274120 81/314 (26%)
M1_LTA4H 24..484 CDD:189006 81/314 (26%)
Substrate binding. /evidence=ECO:0000250 298..302 2/3 (67%)
Leuk-A4-hydro_C 504..644 CDD:286244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155445
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.