DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31445 and VB0395L.1

DIOPT Version :9

Sequence 1:NP_001263064.1 Gene:CG31445 / 326140 FlyBaseID:FBgn0051445 Length:927 Species:Drosophila melanogaster
Sequence 2:NP_001024932.1 Gene:VB0395L.1 / 3564909 WormBaseID:WBGene00044150 Length:340 Species:Caenorhabditis elegans


Alignment Length:337 Identity:72/337 - (21%)
Similarity:131/337 - (38%) Gaps:64/337 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLLFVLAIGLDLSVANSISRYNHYRLPTALRPQRYYLRILTLLESPDDL--RFAGNVQIVIKALQ 66
            |::|...:...:..:|::..    .:|....|..|.: .|....:|:.:  .:.|::|:...|..
 Worm    33 FVVFGSLLNKTVLPSNNVPS----TIPYITVPSEYNV-FLQFNSTPEAVVREYTGSLQMDFVARD 92

  Fly    67 NTRNITLHSKNLTIDESRITLRQISG------AGNMDNCVSSTSVNPTHDYYIFHTCKELLAGNV 125
            .|:.:..|..: .:..:.|:|...:|      ||..|   .||.|..    ||  ....|.:...
 Worm    93 ITQQLFFHRSD-KVKINSISLEDANGTMTAPTAGAYD---KSTGVQA----YI--PLANLTSQES 147

  Fly   126 YKLFLPFSADL-----TPQLFGY--------YRSSYKDPVTNKTRWLSATQFEPSSARKAFPCFD 177
            |.|.:.|..:|     :|:...|        |...:.:.||:.           |..|...||.|
 Worm   148 YVLRIDFQGELDSETGSPRNLQYSLPNGTIRYSIVFGNSVTSS-----------SGLRYLMPCLD 201

  Fly   178 EPGFKASFVVTLGYHKQFNALSNMPVREIRPHESLANYIWCEFQESVPMSTYLVAYSVNDFSFKP 242
            .|.|.|.|...:.:..::..:||. ..:|:  :|:. |....|..|..:.:..|..::.|....|
 Worm   202 SPDFPAVFNFNIRHSPRYRVISNF-AGQIQ--QSIL-YTATLFAGSFQLDSSQVVLALIDTELAP 262

  Fly   243 STL-PNGALFRTWARPNAIDQCDYAAEFGPKVLQYYEEFFGIR-YPLPKIDQMAVPDFSAGAMEN 305
            .|: .||.....:.|.:.:|...     ..:::|    |...| ..:.|||.:|:||.:  |.:.
 Worm   263 VTVQQNGLTINKYYRQSIVDNIS-----TDRIIQ----FMATRSQQIGKIDVLALPDLT--ATQQ 316

  Fly   306 WGLVKYRESTLL 317
            .|:..|.|:.:|
 Worm   317 PGITFYNENDVL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31445NP_001263064.1 Peptidase_M1 28..426 CDD:279741 69/313 (22%)
M1_APN_2 43..497 CDD:189008 66/298 (22%)
ERAP1_C 578..904 CDD:288671
VB0395L.1NP_001024932.1 GluZincin 63..>224 CDD:301352 38/182 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.