DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31445 and lnpep

DIOPT Version :10

Sequence 1:NP_651689.1 Gene:CG31445 / 326140 FlyBaseID:FBgn0051445 Length:927 Species:Drosophila melanogaster
Sequence 2:XP_002933474.1 Gene:lnpep / 100216271 XenbaseID:XB-GENE-950921 Length:1024 Species:Xenopus tropicalis


Alignment Length:31 Identity:13/31 - (41%)
Similarity:15/31 - (48%) Gaps:1/31 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 GP-PNENNSCFDHSHYKKYYGLQNISPCQYG 377
            || |..:||.|:.|||......|.....|||
 Frog   431 GPQPVHSNSVFNPSHYPNSTSSQQSVLSQYG 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31445NP_651689.1 M1_APN-Q_like 37..492 CDD:341064 13/31 (42%)
ERAP1_C 577..905 CDD:463368
lnpepXP_002933474.1 M1_APN-Q_like 174..609 CDD:341064 13/31 (42%)
ERAP1_C 687..1003 CDD:463368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.