DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and AZF1

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_014756.3 Gene:AZF1 / 854280 SGDID:S000005639 Length:914 Species:Saccharomyces cerevisiae


Alignment Length:243 Identity:62/243 - (25%)
Similarity:103/243 - (42%) Gaps:38/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 PDVEKLQQDLWD-----HTDQEMCVAMADTAGLLREDHNDNEKAKDAEDATQNEKNQEEQVQVQT 160
            ||:..:..|..:     ..||.|.:..|...|.       .||....:|.        :.:..||
Yeast   515 PDISSVSDDATNLIGATKVDQLMLIIQARKKGF-------TEKVNTTQDG--------DLLFNQT 564

  Fly   161 EEVEHCQEQLHNMSIISKGVSARVPKRTK--RNSKSWFCDQCGGVFKSSTYLKLHLQRHSGHKPF 223
            .::      |...|.:..||..  ||.|:  |..|...|..|..:|..:|:|::|::.|.|:|||
Yeast   565 MDI------LPPKSELVGGVEK--PKGTQNTRAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPF 621

  Fly   224 ACDICQAKYYTDNEMRRHRILHTDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQC--QHCDK 286
            .||.|..::.....:|.|..|||..:||:|..|.|.:....:...|..||...:||.|  ::|:|
Yeast   622 VCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNK 686

  Fly   287 AFTSTSTRQKHEMLHTNQRKYHCEICDQWFLRSSHLTLHQSTKLHQRR 334
            .||.....:.|      |.::|.|..:....:.:.:...::..|.:|:
Yeast   687 TFTQLGNMKAH------QNRFHKETLNALTAKLAEMNPSENIPLEERQ 728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071
COG5048 <174..337 CDD:227381 48/165 (29%)
C2H2 Zn finger 197..217 CDD:275370 6/19 (32%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
C2H2 Zn finger 253..273 CDD:275368 4/19 (21%)
zf-H2C2_2 268..290 CDD:290200 9/23 (39%)
C2H2 Zn finger 281..301 CDD:275368 6/21 (29%)
C2H2 Zn finger 309..328 CDD:275368 1/18 (6%)
AZF1NP_014756.3 COG5048 342..768 CDD:227381 62/243 (26%)
C2H2 Zn finger 595..615 CDD:275368 6/19 (32%)
C2H2 Zn finger 623..643 CDD:275368 5/19 (26%)
C2H2 Zn finger 651..671 CDD:275368 4/19 (21%)
C2H2 Zn finger 679..702 CDD:275368 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.