DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and DOT5

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_172787.1 Gene:DOT5 / 837889 AraportID:AT1G13290 Length:302 Species:Arabidopsis thaliana


Alignment Length:140 Identity:30/140 - (21%)
Similarity:45/140 - (32%) Gaps:39/140 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 GHKPFACDICQAKYYTDNEMRRHRILH-----------------TDARPYACRFCSKTYRGCSSK 266
            |...|:|.:|...:...|.|:.|...|                 :......|..|::   ||.:.
plant    97 GPTQFSCSVCNKTFNRFNNMQMHMWGHGSQYRKGPESLRGTKSSSSILRLPCYCCAE---GCKNN 158

  Fly   267 VVHER-----------THTNE----RPFQC-QHCDKAFTSTSTRQKHEMLHTNQRKYHCEICDQW 315
            :.|.|           ||...    :||:| :.|:|.|......:.||   .|..|....:|...
plant   159 IDHPRSKPLKDFRTLQTHYKRKHGAKPFRCRKKCEKTFAVRGDWRTHE---KNCGKLWFCVCGSD 220

  Fly   316 FLRSSHLTLH 325
            |.....|..|
plant   221 FKHKRSLKDH 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071
COG5048 <174..337 CDD:227381 30/140 (21%)
C2H2 Zn finger 197..217 CDD:275370
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
C2H2 Zn finger 253..273 CDD:275368 6/30 (20%)
zf-H2C2_2 268..290 CDD:290200 10/37 (27%)
C2H2 Zn finger 281..301 CDD:275368 6/20 (30%)
C2H2 Zn finger 309..328 CDD:275368 4/17 (24%)
DOT5NP_172787.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.