DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and ZNF8

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_066575.2 Gene:ZNF8 / 7554 HGNCID:13154 Length:575 Species:Homo sapiens


Alignment Length:370 Identity:87/370 - (23%)
Similarity:148/370 - (40%) Gaps:107/370 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 QLD---RILTFRNKCLEVHKSFMAANRKLLRKKAIVDEELDKPDV-EKLQQ--DLW--DHTDQEM 118
            |||   ||| :|:..||.....::           :..||.||:| .:|:|  :||  :....:.
Human    41 QLDPTQRIL-YRDVMLETFGHLLS-----------IGPELPKPEVISQLEQGTELWVAERGTTQG 93

  Fly   119 C----------VAMADTAGLLRED--HNDNEK------------AKDAEDATQN----EKNQEEQ 155
            |          .|.....||..|:  |....:            .||.|..:|:    |:|..:|
Human    94 CHPAWEPRSESQASRKEEGLPEEEPSHVTGREGFPTDAPYPTTLGKDRECQSQSLALKEQNNLKQ 158

  Fly   156 VQVQTEEV-------------EHC-------------------------QEQLHNMSIIS----- 177
            ::...:|.             |:|                         .:..||.|::|     
Human   159 LEFGLKEAPVQDQGYKTLRLRENCVLSSSPNPFPEISRGEYLYTYDSQITDSEHNSSLVSQQTGS 223

  Fly   178 ------------KGVSARVP----KRTKRNSKSWFCDQCGGVFKSSTYLKLHLQRHSGHKPFACD 226
                        :..|..:|    .:::...|.:.|..||..|..:.:|.:|.:.|:|.:|:.|.
Human   224 PGKQPGENSDCHRDSSQAIPITELTKSQVQDKPYKCTDCGKSFNHNAHLTVHKRIHTGERPYMCK 288

  Fly   227 ICQAKYYTDNEMRRHRILHTDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDKAFTST 291
            .|...:..::.:.:|..:||..:||.|..|.|::...:...||.|.||.|:|::||.|.:||...
Human   289 ECGKAFSQNSSLVQHERIHTGDKPYKCAECGKSFCHSTHLTVHRRIHTGEKPYECQDCGRAFNQN 353

  Fly   292 STRQKHEMLHTNQRKYHCEICDQWFLRSSHLTLHQSTKLHQRRAE 336
            |:..:|:..||.::.|.|.:|.:.|.|::.|.||..|...:|..|
Human   354 SSLGRHKRTHTGEKPYTCSVCGKSFSRTTCLFLHLRTHTEERPYE 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 9/22 (41%)
COG5048 <174..337 CDD:227381 51/184 (28%)
C2H2 Zn finger 197..217 CDD:275370 6/19 (32%)
C2H2 Zn finger 225..245 CDD:275368 3/19 (16%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 268..290 CDD:290200 12/21 (57%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
C2H2 Zn finger 309..328 CDD:275368 7/18 (39%)
ZNF8NP_066575.2 KRAB 25..85 CDD:214630 17/55 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..130 6/37 (16%)
COG5048 <167..404 CDD:227381 55/232 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..237 4/26 (15%)
C2H2 Zn finger 259..279 CDD:275368 6/19 (32%)
C2H2 Zn finger 287..307 CDD:275368 3/19 (16%)
C2H2 Zn finger 315..335 CDD:275368 6/19 (32%)
C2H2 Zn finger 343..363 CDD:275368 7/19 (37%)
C2H2 Zn finger 371..391 CDD:275368 7/19 (37%)
zf-C2H2 397..419 CDD:306579 1/2 (50%)
C2H2 Zn finger 399..419 CDD:275368 87/370 (24%)
zf-C2H2 467..489 CDD:306579
C2H2 Zn finger 469..489 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 488..533
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.