| Sequence 1: | NP_731558.1 | Gene: | CG31441 / 326139 | FlyBaseID: | FBgn0051441 | Length: | 341 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001347505.1 | Gene: | Zfp110 / 65020 | MGIID: | 1890378 | Length: | 832 | Species: | Mus musculus |
| Alignment Length: | 234 | Identity: | 60/234 - (25%) |
|---|---|---|---|
| Similarity: | 102/234 - (43%) | Gaps: | 50/234 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 133 HNDNEKAKDAEDATQNEKN--------------QEEQVQV------------------QTEEVEH 165
Fly 166 CQE--QLHNMSI----ISKGVSARVPKRTKRNSKSWFCDQCGGVFKSSTYLKLHLQRHSGHKPFA 224
Fly 225 CDICQAKYYTDNEMRRHRILHTDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDKAFT 289
Fly 290 STSTRQKHEMLHTNQRKYHCEICDQWFLRSSHLTLHQST 328 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG31441 | NP_731558.1 | zf-AD | 7..82 | CDD:285071 | |
| COG5048 | <174..337 | CDD:227381 | 52/159 (33%) | ||
| C2H2 Zn finger | 197..217 | CDD:275370 | 6/19 (32%) | ||
| C2H2 Zn finger | 225..245 | CDD:275368 | 3/19 (16%) | ||
| C2H2 Zn finger | 253..273 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 268..290 | CDD:290200 | 11/21 (52%) | ||
| C2H2 Zn finger | 281..301 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 309..328 | CDD:275368 | 9/18 (50%) | ||
| Zfp110 | NP_001347505.1 | KRAB | 18..77 | CDD:214630 | |
| SCAN | 159..246 | CDD:307924 | |||
| KRAB | 283..324 | CDD:307490 | |||
| C2H2 Zn finger | 663..682 | CDD:275370 | 4/18 (22%) | ||
| C2H2 Zn finger | 690..710 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 702..727 | CDD:316026 | 7/24 (29%) | ||
| C2H2 Zn finger | 718..738 | CDD:275368 | 3/19 (16%) | ||
| zf-H2C2_2 | 730..754 | CDD:316026 | 7/23 (30%) | ||
| C2H2 Zn finger | 746..766 | CDD:275368 | 6/19 (32%) | ||
| zf-C2H2 | 772..794 | CDD:306579 | 8/21 (38%) | ||
| C2H2 Zn finger | 774..794 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 786..811 | CDD:316026 | 9/24 (38%) | ||
| C2H2 Zn finger | 802..822 | CDD:275368 | 10/20 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||