| Sequence 1: | NP_731558.1 | Gene: | CG31441 / 326139 | FlyBaseID: | FBgn0051441 | Length: | 341 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001344376.1 | Gene: | Zfp24 / 59057 | MGIID: | 1929704 | Length: | 368 | Species: | Mus musculus |
| Alignment Length: | 365 | Identity: | 77/365 - (21%) |
|---|---|---|---|
| Similarity: | 124/365 - (33%) | Gaps: | 129/365 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 61 VQLDRILTFRNKCLEVHKSFMAANRKLLRKKAIVDEELDK---------PDVEKLQQ-------- 108
Fly 109 ----------------DLW----DHTDQEM--CVAMADTAGLL--------REDHNDN-EKA--- 139
Fly 140 --------------------------------KDAEDATQNE----KNQEEQVQVQTEEVEHCQE 168
Fly 169 Q--------LHNMSIISKGVSARVP-------------------------KRTKRNSKSWFCDQC 200
Fly 201 GGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRHRILHTDARPYACRFCSKTYRGCSS 265
Fly 266 KVVHERTHTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQR 305 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG31441 | NP_731558.1 | zf-AD | 7..82 | CDD:285071 | 6/20 (30%) |
| COG5048 | <174..337 | CDD:227381 | 43/157 (27%) | ||
| C2H2 Zn finger | 197..217 | CDD:275370 | 8/19 (42%) | ||
| C2H2 Zn finger | 225..245 | CDD:275368 | 3/19 (16%) | ||
| C2H2 Zn finger | 253..273 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 268..290 | CDD:290200 | 9/21 (43%) | ||
| C2H2 Zn finger | 281..301 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 309..328 | CDD:275368 | |||
| Zfp24 | NP_001344376.1 | SCAN | 48..159 | CDD:128708 | 14/110 (13%) |
| COG5048 | <249..329 | CDD:227381 | 27/79 (34%) | ||
| Necessary and sufficient for nuclear localization. /evidence=ECO:0000250 | 251..301 | 16/49 (33%) | |||
| C2H2 Zn finger | 253..273 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 281..301 | CDD:275368 | 3/19 (16%) | ||
| COG5048 | 305..>358 | CDD:227381 | 17/52 (33%) | ||
| C2H2 Zn finger | 309..329 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 337..357 | CDD:275368 | 5/19 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||