DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and CG1792

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:359 Identity:107/359 - (29%)
Similarity:165/359 - (45%) Gaps:50/359 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CRTCGKNVTNLQGRATKLFNKSNYHFISILENITDMYL--EFDTTLPHLICQCCKVQLDRILTFR 70
            |||||..:  .....:.||.:.|...:..:|.:|.::|  .....||..||..|::.|...:.||
  Fly     6 CRTCGLFI--FCSTPSNLFEEPNSVMLHQIEVLTGLFLLGGPGNELPPFICSPCELDLQTAIAFR 68

  Fly    71 NKCLEVHKSFMAA----NRKLLRKKAIVDEELDKPDVEKLQQDLWDHTDQEMCVAMADTAGLLRE 131
            .:.:...|:...:    |.:|:...|:        .|||..|...:.|:.|:       ..||.|
  Fly    69 ERVIRTQKTLQESPNLGNAELIESFAV--------GVEKEIQYAEEVTEIEV-------IDLLPE 118

  Fly   132 DHNDNEKAKDAEDATQNEKNQEEQVQVQTEE-------------------VEHCQEQLHNMSIIS 177
            :|...|..:..|...|||   :.||:|..:|                   .::.|......|.::
  Fly   119 EHLLEETEEPYEICEQNE---QPQVKVPAQEKKLRRSTKTTPTVFTSVKFADNSQATRTQWSRLT 180

  Fly   178 KGVSARVPKRTKRNSKSWFCDQCGGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRHR 242
            :  ...|..:.:|..:...|:|||..|...:..||||.||:|.|.||||.|..::||...:|||:
  Fly   181 E--DEVVALKRERRKRDCICEQCGRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFYTATLLRRHQ 243

  Fly   243 ILHTDARPYACRFCSKTYRGCSSKVVHER-THTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQRK 306
            .||.....:.||:|..||...|.::.||| .|||.:||.|:.|:|:|..:...:.|.:.||..|.
  Fly   244 ELHAGNALFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHTGVRA 308

  Fly   307 YHCEICDQWFLRSSHLTLHQSTK--LHQRRAESA 338
            :||:.|...|:|.||||.|..:|  .|...|::|
  Fly   309 FHCDSCQVSFVRRSHLTSHYRSKGHAHTSSAQAA 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 20/75 (27%)
COG5048 <174..337 CDD:227381 63/165 (38%)
C2H2 Zn finger 197..217 CDD:275370 9/19 (47%)
C2H2 Zn finger 225..245 CDD:275368 8/19 (42%)
C2H2 Zn finger 253..273 CDD:275368 9/20 (45%)
zf-H2C2_2 268..290 CDD:290200 12/22 (55%)
C2H2 Zn finger 281..301 CDD:275368 5/19 (26%)
C2H2 Zn finger 309..328 CDD:275368 9/18 (50%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 20/75 (27%)
C2H2 Zn finger 198..218 CDD:275368 9/19 (47%)
C2H2 Zn finger 226..243 CDD:275368 7/16 (44%)
C2H2 Zn finger 254..275 CDD:275368 9/20 (45%)
zf-C2H2 281..303 CDD:278523 6/21 (29%)
C2H2 Zn finger 283..303 CDD:275368 5/19 (26%)
zf-H2C2_2 296..320 CDD:290200 8/23 (35%)
C2H2 Zn finger 311..329 CDD:275368 9/17 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.