DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and CG14710

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster


Alignment Length:354 Identity:89/354 - (25%)
Similarity:142/354 - (40%) Gaps:70/354 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LPHLICQCCKVQLDRILTFRNKCL--EVHKSFMAANRKLLRKKA----------------IVDEE 97
            ||...|..|...:.....||..||  :|:....::.|.....:|                :..|.
  Fly    52 LPEKACNSCCEFVQMWFNFRQMCLNSQVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTEN 116

  Fly    98 LDKPDVEKLQQDLWDHTDQEMCVAMADTAGL-----LREDHNDNEKAKDA-----EDATQNEKNQ 152
            .:|.::..:::.  |...::....:.|..|.     :.||...|.::.:.     .|:..:::..
  Fly   117 QEKEEITAIEEG--DEQQEDQSQEVLDFNGFIINESIEEDEEPNTESPEQILISHMDSYVDDQQM 179

  Fly   153 EEQVQVQTE------------EVEHCQEQLHNMSIISKGVSARVPK-------------RTKR-- 190
            ||.:..:.|            |||:..|:|...|..|...|.::.|             :.||  
  Fly   180 EELIDDKGELVEELSNANTFYEVEYGDEELLMSSAPSPHPSFKMDKQKPGRPRKPDAELKFKRKD 244

  Fly   191 -NSK------------SWFCDQCGGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRHR 242
             |:|            .:.|..||.||...:....|:..||.:||..|:||...:....|:|.|.
  Fly   245 INAKERGNQPKCKEEEKFMCILCGNVFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQMGELRAHI 309

  Fly   243 ILHTDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQRKY 307
            ..||..|||.|.:|.:.:...|.:|.|||.|||.||:.||.|.|.||.|:..:.|.:.|:.|:.|
  Fly   310 RRHTGDRPYKCMYCDRHFYDRSERVRHERVHTNTRPYACQECGKTFTHTAILKNHILSHSAQKNY 374

  Fly   308 HCEICDQWFLRSSHLTLHQSTKLHQRRAE 336
            :|.||.:.|.....|..|..|..|:.:.|
  Fly   375 NCGICCKSFTLLHQLKAHLQTLTHRNKME 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 9/32 (28%)
COG5048 <174..337 CDD:227381 61/191 (32%)
C2H2 Zn finger 197..217 CDD:275370 6/19 (32%)
C2H2 Zn finger 225..245 CDD:275368 6/19 (32%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
zf-H2C2_2 268..290 CDD:290200 13/21 (62%)
C2H2 Zn finger 281..301 CDD:275368 8/19 (42%)
C2H2 Zn finger 309..328 CDD:275368 6/18 (33%)
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 9/30 (30%)
COG5048 <261..395 CDD:227381 50/133 (38%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-C2H2 290..312 CDD:278523 6/21 (29%)
C2H2 Zn finger 292..312 CDD:275368 6/19 (32%)
zf-H2C2_2 304..327 CDD:290200 10/22 (45%)
C2H2 Zn finger 320..340 CDD:275368 7/19 (37%)
zf-H2C2_2 335..357 CDD:290200 13/21 (62%)
C2H2 Zn finger 348..368 CDD:275368 8/19 (42%)
C2H2 Zn finger 376..395 CDD:275368 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I8439
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.