DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and CG6689

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster


Alignment Length:472 Identity:107/472 - (22%)
Similarity:170/472 - (36%) Gaps:156/472 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELRSICRTCGKNVTNLQGRATKLFNKSNYHFISILENITDMYLEFDTTLPHLICQCCKVQLDR 65
            :.||:. ||||..:.| ...||..||:.:|...:..:|.|:.:::......|.|:|..||..||:
  Fly   161 LEELQK-CRTCYNDFT-ADFRAKDLFDPANSVLLFHIEVISGVWISHKPDEPRLMCPACKSALDQ 223

  Fly    66 ILTFRNKCLEVHKSFMAANRKLLRKKAIVDE---ELDKPDVEKLQQDLWDHTDQEMCVAMADTAG 127
            .:.||..|:       :...||.:.|...||   |.:..:......||...|:......:.|..|
  Fly   224 AIDFREMCI-------STELKLSQAKPSTDEVQIEAENENPISSDHDLISDTENTNVEEIEDAGG 281

  Fly   128 LLREDHNDNEKAKDAEDATQNEKNQEEQVQVQTEEVEHCQEQLHNMSII---------------- 176
                ||.::|       ||.:::..:|.|    :||.........:|:.                
  Fly   282 ----DHVEDE-------ATSDDQTSQEAV----DEVAESPAAQDPLSVALGAKIFKELLDQYTGK 331

  Fly   177 ------------------SKGVSARVPKRT-------KRN----------SKSWFCDQCGGVFKS 206
                              .|....:.|||:       :||          ..::.|||||..|:.
  Fly   332 EKARLRKGAPIASKPKAKEKAAGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQAFRM 396

  Fly   207 STYLKLHLQRHS-----------------------------GHKPFACDICQAKYYTDNEMRRH- 241
            |..|::|:.||:                             |..||||..|...:......::| 
  Fly   397 SHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHE 461

  Fly   242 --------RIL---------------------------------------HTDARPYACRFCSKT 259
                    |::                                       ||||..|.|:.|||:
  Fly   462 SEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKS 526

  Fly   260 YRGCSSKVVHERTHTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQRKYHCEICDQWFLRSSHLTL 324
            |...:....||.|| .:||.||..|.|.|...:..::||::||.:|.|.||:|:..|....::..
  Fly   527 YSDPNKLKRHEMTH-EKRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKS 590

  Fly   325 HQSTKLHQRRAESARIV 341
            |.::|:||..|....:|
  Fly   591 HANSKMHQDNARKLGVV 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 22/74 (30%)
COG5048 <174..337 CDD:227381 62/290 (21%)
C2H2 Zn finger 197..217 CDD:275370 9/19 (47%)
C2H2 Zn finger 225..245 CDD:275368 4/67 (6%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
zf-H2C2_2 268..290 CDD:290200 11/21 (52%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
C2H2 Zn finger 309..328 CDD:275368 5/18 (28%)
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 24/80 (30%)
zf-C2H2 385..407 CDD:278523 9/21 (43%)
C2H2 Zn finger 387..407 CDD:275368 9/19 (47%)
zf-H2C2_2 399..422 CDD:290200 4/22 (18%)
C2H2 Zn finger 415..436 CDD:275368 0/20 (0%)
C2H2 Zn finger 444..460 CDD:275368 2/15 (13%)
C2H2 Zn finger 492..512 CDD:275368 0/19 (0%)
C2H2 Zn finger 520..540 CDD:275368 7/19 (37%)
C2H2 Zn finger 547..567 CDD:275368 6/19 (32%)
zf-met 574..597 CDD:289631 6/22 (27%)
C2H2 Zn finger 575..591 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457871
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.980

Return to query results.
Submit another query.