DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and CG4820

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster


Alignment Length:374 Identity:108/374 - (28%)
Similarity:174/374 - (46%) Gaps:67/374 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRSICRTCGKNVTNLQGRATKLFNKSNYHFISILENITDMYLEFDTTLPHLICQCCKVQLDRILT 68
            ::..||||||.|  :.....::|..:....:..:.:||:.:|:....||:.||..|:|.|.::..
  Fly     1 MKEFCRTCGKTV--VADECLQIFTPAGRKLLQCVRSITNCWLQNVQDLPNHICTDCQVLLSQVQK 63

  Fly    69 FRNKCLEVHKSFMAANRKL-----------LRKKAI-------VDEELDKPDVE----KLQ---- 107
            ||.:|.::.|.|....|::           ||.:..       :||.:...|::    :||    
  Fly    64 FRRRCAKIEKYFARRRRRMNLGEAPAAMEQLRVQQAAAPDPLGIDELMSASDIKIEPIQLQMEED 128

  Fly   108 -QDLWDHTDQEMCVAMADTAG----LLREDHNDNEKAKDAEDATQNEKNQEEQVQVQTEEVEHCQ 167
             |..:.....|..::..:..|    .|.||:        .|..|:......|..|.:::.....:
  Fly   129 PQAPYPENQLEQALSYGNAPGEDILPLPEDY--------GEAQTEVATTTNEPAQRRSKNTAKIK 185

  Fly   168 EQLHNMSIISKGVSARV-----PKR-TKRN---SKSWFCDQCGGVFKSSTYLKLHLQRHSGHKPF 223
            .:.|.|.:..|.:..:|     ||| ..||   :|...|:.||..||.::.|.:||.||:|.|||
  Fly   186 SKKHTMRVGRKLIHVKVIDDKQPKRIVDRNGPSAKPCICEHCGRQFKDTSNLHVHLLRHTGTKPF 250

  Fly   224 ACDICQAKYYTDNEMRRHRILHTDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDKAF 288
            .||.|..|.||.:.:|||::.||:. ||||.||...|...||:|.|||          :.|.|  
  Fly   251 ECDQCHQKCYTLHLLRRHQLKHTEG-PYACTFCGLEYSTNSSRVRHER----------EACKK-- 302

  Fly   289 TSTSTRQKHEMLHTNQRKYHCEICDQWFLRSSHLTLHQSTKLH---QRR 334
             ..:.:.|.|::...:|.:|||:||.||||:.:.|.|.::..|   :||
  Fly   303 -GRAPQSKWEIIKKGERTFHCEVCDLWFLRAGNFTQHINSSSHIENERR 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 23/74 (31%)
COG5048 <174..337 CDD:227381 65/173 (38%)
C2H2 Zn finger 197..217 CDD:275370 8/19 (42%)
C2H2 Zn finger 225..245 CDD:275368 9/19 (47%)
C2H2 Zn finger 253..273 CDD:275368 10/19 (53%)
zf-H2C2_2 268..290 CDD:290200 5/21 (24%)
C2H2 Zn finger 281..301 CDD:275368 4/19 (21%)
C2H2 Zn finger 309..328 CDD:275368 10/18 (56%)
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071 22/72 (31%)
C2H2 Zn finger 224..244 CDD:275368 8/19 (42%)
C2H2 Zn finger 252..272 CDD:275368 9/19 (47%)
C2H2 Zn finger 279..297 CDD:275368 8/17 (47%)
C2H2 Zn finger 322..339 CDD:275368 9/16 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.