DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and ouib

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib / 41039 FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster


Alignment Length:351 Identity:94/351 - (26%)
Similarity:162/351 - (46%) Gaps:56/351 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRSICRTCGKNVTNLQGRATKLFNKSNYHFISILENITDMYLEFDTTLPHLICQCCKVQLDRILT 68
            |..:||.||:.  .:..::..||:..|..::..|..|:.:.|.....:|..:|.||:.:|...|.
  Fly     2 LNIVCRVCGRQ--KICEKSLNLFDLVNRKYLKHLHMISGLRLVDLDDVPGFMCLCCQAELRSALA 64

  Fly    69 FRNKCLEVHKSFMAANRKLLRKKAIVDEELDKPDVEKLQQDLWDHTDQEMCVAMADTAGLLREDH 133
            ||..|::....::.           ::::....|                            ||.
  Fly    65 FRKLCIKTQTKWLT-----------IEDDSSSGD----------------------------EDT 90

  Fly   134 NDNEKAKDAEDATQN--EKNQ----EEQVQVQTEEV-------EHCQEQLHNMSIISKGVSAR-- 183
            |||.:.:..:.|..:  :|.:    ||..||..||.       ...:.||....|..|.|.::  
  Fly    91 NDNSELESEKCAFSDFGKKKEGELVEETFQVLIEEEPMDKTLNRDAKAQLREDGIDEKCVPSQKI 155

  Fly   184 VPKRTKRNSKSWFCDQCGGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRHRILHTDA 248
            :...||.:.:.:.|:.||....|....:.|:::|.|.:||.|..|.|::.:..|:|.|..:||..
  Fly   156 IKVSTKLDDQIYICELCGTHATSKPTFQRHMRKHRGERPFGCKDCDARFLSAGELRAHHRVHTGE 220

  Fly   249 RPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQRKYHCEICD 313
            :|:|||||.|.|.....:::|||||||:||:.|:.|.|.||:....:.|.::||.:|.:.|:|||
  Fly   221 QPFACRFCEKRYVSYMGRLIHERTHTNDRPYVCEECGKKFTTAYVLKNHMVIHTGERNFRCDICD 285

  Fly   314 QWFLRSSHLTLHQSTKLHQRRAESAR 339
            :.|.|.:||..|..:.:|.:..:..:
  Fly   286 RSFQRKAHLVTHTRSMMHLQNVKKQK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 19/74 (26%)
COG5048 <174..337 CDD:227381 58/164 (35%)
C2H2 Zn finger 197..217 CDD:275370 5/19 (26%)
C2H2 Zn finger 225..245 CDD:275368 6/19 (32%)
C2H2 Zn finger 253..273 CDD:275368 9/19 (47%)
zf-H2C2_2 268..290 CDD:290200 13/21 (62%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
C2H2 Zn finger 309..328 CDD:275368 9/18 (50%)
ouibNP_649822.2 zf-AD 5..78 CDD:214871 19/74 (26%)
COG5048 <158..300 CDD:227381 54/141 (38%)
C2H2 Zn finger 169..189 CDD:275368 5/19 (26%)
C2H2 Zn finger 197..217 CDD:275368 6/19 (32%)
zf-H2C2_2 209..234 CDD:290200 13/24 (54%)
C2H2 Zn finger 225..245 CDD:275368 9/19 (47%)
zf-H2C2_2 241..262 CDD:290200 13/20 (65%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 266..288 CDD:290200 8/21 (38%)
C2H2 Zn finger 281..299 CDD:275368 9/17 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I17286
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.