DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and CG17568

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster


Alignment Length:305 Identity:81/305 - (26%)
Similarity:128/305 - (41%) Gaps:36/305 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DMYLEFDTTLPHLICQCCKVQLDRILTFRNKCLEVHK-SFMAANRKLLRKKAIVDEELDKPDV-- 103
            :|.:...||..||           |.|.:|..:|:.| .|:.....||.|..   .:||..||  
  Fly   153 EMEISKRTTTTHL-----------IQTKKNVEMEIPKQEFIDLGPILLEKNT---SQLDMEDVLD 203

  Fly   104 ----EKLQQDLWDHTDQEMCVAMADTAGLLREDHNDNE------KAKD--AEDATQN--EKNQEE 154
                |:|.|...|.|.....:.....:.:|.....|::      :..|  |...|.|  |...||
  Fly   204 ELPQEELSQPRLDSTTSPASMENDVKSEMLDSCEGDDDFLPVDGQLMDLVAVATTPNTLESTAEE 268

  Fly   155 QVQVQTEEVEHCQEQLHNMSIISKGVS---ARVPKRTKRNSKSWFCDQCGGVFKSSTYLKLHLQR 216
            :.:....:.|.|.:...|.:...|.:.   .|:.:|.|.:..:..||.|.....|:|.||||.:.
  Fly   269 KAKRGRMDCEKCGKVYRNRASYEKHLERECRRIERRVKVDKTTTTCDICNKTLSSATALKLHKEG 333

  Fly   217 -HSGHKPFACDICQAKYYTDNEMRRHRILHTDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQ 280
             |...||:.||.|..:..|...:..|:::||::||:.|..|...::..:....|.:.|. |..|.
  Fly   334 IHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECTVCKAGFKNRARLKAHYQIHA-EPSFV 397

  Fly   281 CQHCDKAFTSTSTRQKHEMLHTNQRKYHCEICDQWFLRSSHLTLH 325
            |..|.|...:..|...|:::||.:|:..|::|...|.||..|..|
  Fly   398 CNICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTH 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 11/40 (28%)
COG5048 <174..337 CDD:227381 46/156 (29%)
C2H2 Zn finger 197..217 CDD:275370 9/20 (45%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
C2H2 Zn finger 253..273 CDD:275368 3/19 (16%)
zf-H2C2_2 268..290 CDD:290200 7/21 (33%)
C2H2 Zn finger 281..301 CDD:275368 5/19 (26%)
C2H2 Zn finger 309..328 CDD:275368 7/17 (41%)
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 42/131 (32%)
C2H2 Zn finger 314..335 CDD:275368 9/20 (45%)
C2H2 Zn finger 343..363 CDD:275368 5/19 (26%)
C2H2 Zn finger 371..391 CDD:275368 3/19 (16%)
C2H2 Zn finger 398..418 CDD:275368 5/19 (26%)
C2H2 Zn finger 426..446 CDD:275368 7/17 (41%)
zf-H2C2_2 439..463 CDD:290200 2/4 (50%)
C2H2 Zn finger 454..475 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.