DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and Paris

DIOPT Version :10

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_608840.1 Gene:Paris / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster


Alignment Length:342 Identity:83/342 - (24%)
Similarity:139/342 - (40%) Gaps:48/342 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRSICRTCGKNVTNLQGRATKLFNKSNYHFISILENIT----------DMYLEFDTTLPHLICQC 58
            :..|||.|    .::.|:...:|:......:||.|.|.          |::.|       :||..
  Fly     1 MAEICRVC----MDISGKLVNIFDARRRTRVSIAEMIAQCTGFEVKRGDLFSE-------MICPQ 54

  Fly    59 CKVQLDRILTFRNKCLEVHKSFMAANRKLLRKKAIVDEELDKPDVEKLQQDLWDHTDQEMCVAMA 123
            |...:......|..|.|.|:.:.          .:.||.::......|:::.|:.::.|  .|..
  Fly    55 CYEDVKSAYGIRQTCEESHQFYC----------RVRDEGIEDALCALLEEEDWEISEDE--DARI 107

  Fly   124 DTAGLLREDHNDNEKAKDAEDATQNEKNQEE---------QVQVQTEEVEHCQEQLHNMSIISKG 179
            |:|....:|...:.|....|....::|.|.:         .:..|:....:|:....      ..
  Fly   108 DSASAADDDGKSDSKKVAFECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFR------LR 166

  Fly   180 VSARVPKRTKRNSKSWFCDQCGGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRHRIL 244
            |:.:...:|...:|.:.|..|...|...:.|:.|.:.|:|.:||.|..|...:...:::|||...
  Fly   167 VTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRT 231

  Fly   245 HTDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQRKYHC 309
            |...||:.|..|:||:........|.|:||.||||:|.||.|||......::|..||...|.:.|
  Fly   232 HGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRC 296

  Fly   310 EICDQWFLRSSHLTLHQ 326
            ..|.:.|..||.|..|:
  Fly   297 SHCPKTFRLSSTLKEHK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..81 CDD:462262 19/83 (23%)
COG5048 <174..337 CDD:227381 49/153 (32%)
C2H2 Zn finger 197..217 CDD:275370 5/19 (26%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 269..290 CDD:463886 14/20 (70%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
C2H2 Zn finger 309..328 CDD:275368 7/18 (39%)
ParisNP_608840.1 zf-AD 4..78 CDD:462262 19/94 (20%)
C2H2 Zn finger 128..148 CDD:275368 2/19 (11%)
C2H2 Zn finger 156..176 CDD:275368 2/25 (8%)
COG5048 <180..341 CDD:227381 47/134 (35%)
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..232 CDD:275368 5/19 (26%)
C2H2 Zn finger 240..260 CDD:275368 6/19 (32%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
C2H2 Zn finger 296..316 CDD:275368 7/18 (39%)
C2H2 Zn finger 324..341 CDD:275368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.