DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and CG15436

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster


Alignment Length:342 Identity:83/342 - (24%)
Similarity:139/342 - (40%) Gaps:48/342 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRSICRTCGKNVTNLQGRATKLFNKSNYHFISILENIT----------DMYLEFDTTLPHLICQC 58
            :..|||.|    .::.|:...:|:......:||.|.|.          |::.|       :||..
  Fly     1 MAEICRVC----MDISGKLVNIFDARRRTRVSIAEMIAQCTGFEVKRGDLFSE-------MICPQ 54

  Fly    59 CKVQLDRILTFRNKCLEVHKSFMAANRKLLRKKAIVDEELDKPDVEKLQQDLWDHTDQEMCVAMA 123
            |...:......|..|.|.|:.:.          .:.||.::......|:::.|:.::.|  .|..
  Fly    55 CYEDVKSAYGIRQTCEESHQFYC----------RVRDEGIEDALCALLEEEDWEISEDE--DARI 107

  Fly   124 DTAGLLREDHNDNEKAKDAEDATQNEKNQEE---------QVQVQTEEVEHCQEQLHNMSIISKG 179
            |:|....:|...:.|....|....::|.|.:         .:..|:....:|:....      ..
  Fly   108 DSASAADDDGKSDSKKVAFECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFR------LR 166

  Fly   180 VSARVPKRTKRNSKSWFCDQCGGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRHRIL 244
            |:.:...:|...:|.:.|..|...|...:.|:.|.:.|:|.:||.|..|...:...:::|||...
  Fly   167 VTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRT 231

  Fly   245 HTDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQRKYHC 309
            |...||:.|..|:||:........|.|:||.||||:|.||.|||......::|..||...|.:.|
  Fly   232 HGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRC 296

  Fly   310 EICDQWFLRSSHLTLHQ 326
            ..|.:.|..||.|..|:
  Fly   297 SHCPKTFRLSSTLKEHK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 19/84 (23%)
COG5048 <174..337 CDD:227381 49/153 (32%)
C2H2 Zn finger 197..217 CDD:275370 5/19 (26%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 268..290 CDD:290200 14/21 (67%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
C2H2 Zn finger 309..328 CDD:275368 7/18 (39%)
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 19/94 (20%)
C2H2 Zn finger 128..148 CDD:275368 2/19 (11%)
C2H2 Zn finger 156..176 CDD:275368 2/25 (8%)
COG5048 <180..341 CDD:227381 47/134 (35%)
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
zf-H2C2_2 197..219 CDD:290200 8/21 (38%)
C2H2 Zn finger 212..232 CDD:275368 5/19 (26%)
zf-H2C2_2 224..249 CDD:290200 10/24 (42%)
C2H2 Zn finger 240..260 CDD:275368 6/19 (32%)
zf-H2C2_2 252..276 CDD:290200 13/23 (57%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
C2H2 Zn finger 296..316 CDD:275368 7/18 (39%)
C2H2 Zn finger 324..341 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.