DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and CG2202

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster


Alignment Length:320 Identity:78/320 - (24%)
Similarity:134/320 - (41%) Gaps:51/320 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DTTLPHLICQCCKVQLDRILTFRNKC-LEVHKSFMAANRKLLRK--------KAIVDEELDKPDV 103
            |...|...|:.|:      .||...| |..||.     ..|.:|        ||....:..|..|
  Fly   468 DEPNPDNRCEVCQ------RTFSRHCHLLRHKL-----SHLEKKPHNCPHCPKAFARSDHLKAHV 521

  Fly   104 EKLQQDLWDHTDQEMCVAMADTAGLLREDHNDNEKAKDAEDATQNEKNQEEQVQVQTEEVEHCQE 168
            :.|      |:::|...::.: |...|.|..:..|. ...:....|...|.::|:.....|:|.:
  Fly   522 QSL------HSNKEHKCSLCE-AAFSRLDALERHKV-SKHNGEGLEPGSELKLQLAEHTCEYCSK 578

  Fly   169 QLHNMSIISK---------------------GVSARVPKRTKRNSKSWFCDQCGGVFKSSTYLKL 212
            :..:.:.:.|                     ....|..::|....:::.|..||..|..:.||::
  Fly   579 RFSSKTYLRKHTLLHTDFLYACKTCDETFRERAQLREHEKTHTGQRNFLCCICGDSFARNDYLRV 643

  Fly   213 HLQRHSGHKPFACDICQAKYYTDNEMRRHRILHTDARPYACRFCSKTYRGCSSKVVHERTHTNER 277
            |::||:|.||:.|..|...:....:::.|...||..:|..|..|.|::....:..:|.||||.||
  Fly   644 HMRRHNGEKPYKCRFCVKAFPRATDLKVHERYHTGTKPNLCNTCGKSFHRAYNLTIHMRTHTGER 708

  Fly   278 PFQCQHCDKAFTSTSTRQKHEMLHTNQRKYHCEICDQWFLRSSHLTLHQSTKLHQRRAES 337
            |::|..|.|:||.::..:.|...||.:| |.|..||.:||:..::..| ....|.:..|:
  Fly   709 PYKCDQCPKSFTQSNDLKAHIRRHTGER-YKCPHCDAYFLQLYNMRNH-CMSAHNKHIET 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 10/34 (29%)
COG5048 <174..337 CDD:227381 49/183 (27%)
C2H2 Zn finger 197..217 CDD:275370 7/19 (37%)
C2H2 Zn finger 225..245 CDD:275368 3/19 (16%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
zf-H2C2_2 268..290 CDD:290200 12/21 (57%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
C2H2 Zn finger 309..328 CDD:275368 6/18 (33%)
CG2202NP_572657.2 zf-AD 45..121 CDD:285071
C2H2 Zn finger 150..171 CDD:275368
C2H2 Zn finger 192..213 CDD:275370
C2H2 Zn finger 221..239 CDD:275370
COG5048 <443..730 CDD:227381 66/280 (24%)
C2H2 Zn finger 476..496 CDD:275368 8/30 (27%)
zf-H2C2_2 488..513 CDD:290200 7/29 (24%)
C2H2 Zn finger 504..525 CDD:275368 5/26 (19%)
C2H2 Zn finger 532..548 CDD:275368 3/16 (19%)
C2H2 Zn finger 573..593 CDD:275368 3/19 (16%)
C2H2 Zn finger 600..620 CDD:275368 1/19 (5%)
zf-H2C2_2 613..637 CDD:290200 6/23 (26%)
C2H2 Zn finger 628..648 CDD:275368 7/19 (37%)
zf-H2C2_2 640..663 CDD:290200 10/22 (45%)
C2H2 Zn finger 656..676 CDD:275368 3/19 (16%)
C2H2 Zn finger 684..704 CDD:275368 5/19 (26%)
zf-C2H2 684..704 CDD:278523 5/19 (26%)
zf-H2C2_2 696..721 CDD:290200 12/24 (50%)
C2H2 Zn finger 712..732 CDD:275368 6/19 (32%)
C2H2 Zn finger 739..755 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457861
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.