DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and CG10959

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster


Alignment Length:369 Identity:79/369 - (21%)
Similarity:134/369 - (36%) Gaps:81/369 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DMYLEFDTTLPHLICQCCKVQ----------------------LDRILTFRNKCLEVHKSFMAAN 84
            :::.|.:.....|:|..|.::                      |.:.:|...:.....:.|...:
  Fly    26 EIFYEPEANRFQLVCLLCDMKHFGFEDFARHIRNVHFDKQGRPLTKTVTGLGRLAREEQEFQGVS 90

  Fly    85 ----------RKLLRKKAIVDEELDKPDVEKLQQD-----------------------LW--DHT 114
                      ::.|..:.::.||.|......|:||                       :|  ||.
  Fly    91 AEPLAVDSFKKEYLPNEDVLSEEEDAEQELGLEQDEGNPLRIMVLGGKQSVDEETIDTMWQPDHD 155

  Fly   115 DQEMCVAMADTAGLLREDHNDNEKAKDAEDATQNEKNQEEQVQVQTEEVEHCQEQLHNMSIISK- 178
            .....|........|....|..:...| ||..:::...::|.|.:.....||..:......::. 
  Fly   156 SSSASVNEGCALEALLGVENPQDYQPD-EDGEEHQSVFKKQRQPKDYNCPHCDRRYTTQKYLNTH 219

  Fly   179 --------------------GVSARVPKRTKRNSKSWFCDQCGGVFKSSTYLKLHLQRHSGHKPF 223
                                .|...:.:..::....:.|..|..|||||..|..|:|.|||.:.|
  Fly   220 LKMSHPFPQAFKCVDCKATFDVDRALAQHRRKEHTEFACQLCDKVFKSSRSLLRHVQGHSGARTF 284

  Fly   224 AC--DICQAKYYTDNEMRRHRILHTDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDK 286
            .|  :.|...:...:.:..||.:|::.|.|.|..|....|...:.:||.||||.|:|||||.|.:
  Fly   285 KCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHRRTHTGEKPFQCQTCAR 349

  Fly   287 AFTSTSTRQKHEMLHTNQRKYHCEICDQWFLRSSHLTLHQSTKL 330
            .|.|.|...:|:.:|:.::.|.|:.||..|.|...|..|:...|
  Fly   350 RFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALYHHKHLHL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 7/61 (11%)
COG5048 <174..337 CDD:227381 52/180 (29%)
C2H2 Zn finger 197..217 CDD:275370 10/19 (53%)
C2H2 Zn finger 225..245 CDD:275368 4/21 (19%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 268..290 CDD:290200 14/21 (67%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
C2H2 Zn finger 309..328 CDD:275368 7/18 (39%)
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 1/20 (5%)
COG5048 <258..416 CDD:227381 51/136 (38%)
C2H2 Zn finger 258..278 CDD:275368 10/19 (53%)
C2H2 Zn finger 289..308 CDD:275368 3/18 (17%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 328..353 CDD:290200 14/24 (58%)
C2H2 Zn finger 344..364 CDD:275368 7/19 (37%)
zf-H2C2_2 357..381 CDD:290200 7/23 (30%)
C2H2 Zn finger 372..392 CDD:275368 7/19 (37%)
C2H2 Zn finger 400..420 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439356
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.