DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and CG32767

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001162674.1 Gene:CG32767 / 31430 FlyBaseID:FBgn0052767 Length:1281 Species:Drosophila melanogaster


Alignment Length:264 Identity:62/264 - (23%)
Similarity:107/264 - (40%) Gaps:28/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 AANRKLLRKKAIVDEELDKPDVEKLQQDLWDHTDQEMCVAMADTAGLLREDHNDNEKAKDAEDAT 146
            ||.::|    |:..|:..:...::.||.......||.     ......::.....::|:..:...
  Fly   401 AAEQQL----ALALEQQRQQQEQQAQQQRQQQQQQEQ-----QRQQQQQQQQQQQQQAQQEQQRQ 456

  Fly   147 QNEKNQEEQVQVQTEEVEH----CQEQLHNMSIISKGVSARVPKRTKRNSKSWFCDQCGGVFKSS 207
            |.::.|::|.|.||..|:|    .....:|.:..|...:...|..|...:.|:.|.:|...|.|.
  Fly   457 QQQQLQQQQQQQQTHPVKHSASGSSSTNNNSTTNSTNSNNNTPAATATVTTSYQCVECVEKFDSK 521

  Fly   208 TYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRHRILHTDARPYACRFCSKTYRGCSSKVVHERT 272
            ....:|...|:.:  ..|.||.....:.....:|.:   ..:||.|:.|.:..|...:.:.|.|.
  Fly   522 ELFDIHRSGHANN--MKCAICNMVLKSLKNYEKHCL---RCKPYECQICGRVVRFRPNFIKHMRV 581

  Fly   273 HTNER----PFQCQHCDKAFTSTSTRQKHEMLHTNQRKYHCEICDQWF-----LRSSHLTLHQST 328
            ||.::    .::|:.|.|.|.|....:.|:.:|.......||||.:.|     || .|..||...
  Fly   582 HTGQQSERHKYKCEVCHKEFMSFEYFKVHKKIHNENVNLTCEICGKVFSALASLR-GHSKLHSGV 645

  Fly   329 KLHQ 332
            |||:
  Fly   646 KLHK 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 62/264 (23%)
COG5048 <174..337 CDD:227381 43/168 (26%)
C2H2 Zn finger 197..217 CDD:275370 5/19 (26%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
zf-H2C2_2 268..290 CDD:290200 8/25 (32%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
C2H2 Zn finger 309..328 CDD:275368 10/23 (43%)
CG32767NP_001162674.1 C2H2 Zn finger 537..557 CDD:275368 4/22 (18%)
C2H2 Zn finger 562..582 CDD:275368 5/19 (26%)
C2H2 Zn finger 594..614 CDD:275368 6/19 (32%)
C2H2 Zn finger 622..642 CDD:275368 8/20 (40%)
zf-C2H2 648..670 CDD:278523 1/2 (50%)
C2H2 Zn finger 650..670 CDD:275368 62/264 (23%)
zf-H2C2_2 662..684 CDD:290200
C2H2 Zn finger 678..698 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457855
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.