DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and ace2

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_594109.1 Gene:ace2 / 2541661 PomBaseID:SPAC6G10.12c Length:533 Species:Schizosaccharomyces pombe


Alignment Length:216 Identity:45/216 - (20%)
Similarity:73/216 - (33%) Gaps:74/216 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DLWDHTDQEMCVA-MADTAGLLRE--------DHN-DNEKAKDAEDATQN------------EKN 151
            |:..|||.:...| ::..|..:.|        ||. |...|......||.            .|.
pombe   304 DVCRHTDNQKAFAKLSSPAEYVSEFEKFSSVCDHGLDISNANINNTLTQQFALSAPYESCIVTKK 368

  Fly   152 QEEQVQVQTEE-----------------VEH-------------CQEQLHNMSIISKGVSARVPK 186
            .|..:.|:.||                 .||             |:.:..:..|      .|:|.
pombe   369 PEPCITVKEEEQLAPKIESADLSITPQVTEHDSKPPVRISYDHRCKTRKQSTRI------CRIPP 427

  Fly   187 RTKRNSKSWFC------------DQCGGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTDNEMR 239
            .|   ..|.:|            :.|.........::.|:|.|...:|:.||:|:|.:...::::
pombe   428 ET---MASLYCGPEADGKYVCLYNGCNKRIARKYNVESHIQTHLSDRPYRCDLCKAGFVRHHDLK 489

  Fly   240 RHRILHTDARPYACRFCSKTY 260
            ||..:|.:.|||.|. |.|.:
pombe   490 RHLRIHENGRPYVCE-CLKRF 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071
COG5048 <174..337 CDD:227381 24/99 (24%)
C2H2 Zn finger 197..217 CDD:275370 4/31 (13%)
C2H2 Zn finger 225..245 CDD:275368 6/19 (32%)
C2H2 Zn finger 253..273 CDD:275368 3/8 (38%)
zf-H2C2_2 268..290 CDD:290200
C2H2 Zn finger 281..301 CDD:275368
C2H2 Zn finger 309..328 CDD:275368
ace2NP_594109.1 COG5048 45..518 CDD:227381 45/216 (21%)
C2H2 Zn finger 448..467 CDD:275368 3/18 (17%)
zf-C2H2 473..495 CDD:278523 6/21 (29%)
C2H2 Zn finger 475..495 CDD:275368 6/19 (32%)
zf-H2C2_2 487..511 CDD:290200 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.