DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31441 and Zfp369

DIOPT Version :9

Sequence 1:	NP_731558.1	Gene:	CG31441 / 326139	FlyBaseID:	FBgn0051441	Length:	341	Species:	Drosophila melanogaster
Sequence 2:	NP_848141.3	Gene:	Zfp369 / 170936	MGIID:	2176229	Length:	845	Species:	Mus musculus

Alignment Length:	138	Identity:	49/138 - (35%)
Similarity:	81/138 - (58%)	Gaps:	2/138 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   197 CDQCGGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRHRILHTDARPYACRFCSKTYR 261
            |.:||.:|:::.|..:|.:.|:|.:|:.|..|...:...:.:.:|..:|:..||:.|..|.:|:.
Mouse   703 CSECGKMFRNARYFSVHKKIHTGERPYMCMSCGKAFVQSSSLTQHLRIHSGERPFECSECGRTFS 767

  Fly   262 GCSSKVVHERTHTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQRKYHCEICDQWFLRSSHLTLHQ 326
            ..|:...|.||||..:|:|||||.|||..:|...:|..:||.:|.|.|..|.:.|.:||:|..||
Mouse   768 DRSAASQHLRTHTGAKPYQCQHCGKAFRQSSHLTRHVRIHTGERPYVCTKCGKAFTQSSNLIGHQ 832

  Fly   327 STKLHQRR 334
            .|  |:::
Mouse   833 KT--HRKK 838

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31441	NP_731558.1	zf-AD	7..82	CDD:285071
		COG5048	<174..337	CDD:227381	49/138 (36%)
		C2H2 Zn finger	197..217	CDD:275370	6/19 (32%)
		C2H2 Zn finger	225..245	CDD:275368	3/19 (16%)
		C2H2 Zn finger	253..273	CDD:275368	6/19 (32%)
		zf-H2C2_2	268..290	CDD:290200	14/21 (67%)
		C2H2 Zn finger	281..301	CDD:275368	9/19 (47%)
		C2H2 Zn finger	309..328	CDD:275368	8/18 (44%)
Zfp369	NP_848141.3	KRAB	35..94	CDD:214630
		KRAB	35..74	CDD:279668
		SCAN	179..266	CDD:280241
		KRAB	300..>340	CDD:214630
		KRAB	300..339	CDD:279668
		C2H2 Zn finger	676..695	CDD:275370
		C2H2 Zn finger	703..723	CDD:275368	6/19 (32%)
		zf-H2C2_2	715..740	CDD:290200	7/24 (29%)
		COG5048	727..>792	CDD:227381	22/64 (34%)
		C2H2 Zn finger	731..751	CDD:275368	3/19 (16%)
		zf-H2C2_2	743..767	CDD:290200	7/23 (30%)
		zf-C2H2	757..779	CDD:278523	6/21 (29%)
		C2H2 Zn finger	759..779	CDD:275368	6/19 (32%)
		zf-C2H2	785..807	CDD:278523	10/21 (48%)
		C2H2 Zn finger	787..807	CDD:275368	9/19 (47%)
		zf-H2C2_2	799..824	CDD:290200	8/24 (33%)
		C2H2 Zn finger	815..835	CDD:275368	9/21 (43%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000