DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and ZNF816

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001026835.1 Gene:ZNF816 / 125893 HGNCID:26995 Length:651 Species:Homo sapiens


Alignment Length:382 Identity:94/382 - (24%)
Similarity:160/382 - (41%) Gaps:83/382 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RATKLFNKSNYHFI-SILENITDMYLEFDTT-----------------LPHLICQCCKVQLDR-I 66
            ||..|.|..|..|: |.|:::    :||.:|                 ..|.|...|..::.: |
Human    50 RAVMLENYRNLEFVDSSLKSM----MEFSSTRHSITGEVIHTGTLQRHKSHHIGDFCFPEMKKDI 110

  Fly    67 LTFRNKCLEV----HKSFMAANRKLLRKKAIVDEEL--DKPDVEKLQQDLWDHTDQEMCVAMADT 125
            ..|..:..||    |::.|...:||.......|...  :||..::|......|..:   :.|..|
Human   111 HHFEFQWQEVERNGHEAPMTKIKKLTGSTDRSDHRHAGNKPIKDQLGLSFHSHLPE---LHMFQT 172

  Fly   126 AGLLREDHNDNEKAKDAEDATQNEK-------------------NQEEQVQ-------------- 157
            .|.:   .|..:|:..|..|:::::                   :...|:|              
Human   173 KGKI---SNQLDKSIGASSASESQRISCRLKTHISNKYGKNFLHSSFTQIQEICMREKPCQSNEC 234

  Fly   158 ---------VQTEEVEHCQEQLHNMSIISKGVSAR----VPKRTKRNSKSWFCDQCGGVFKSSTY 209
                     ::...:.|.:|:.:...:..|..:.:    ...|.....|::.|::||..|...:.
Human   235 GKAFNYSSLLRRHHITHSREREYKCDVCGKIFNQKQYIVYHHRCHTGEKTYKCNECGKTFTQMSS 299

  Fly   210 LKLHLQRHSGHKPFACDICQAKYYTDNEMRRHRILHTDARPYACRFCSKTYRGCSSKVVHERTHT 274
            |..|.:.|:|.||:.|:.|...:...:.:|.||.|||..:||.|..|.||:...|:.|:|:..||
Human   300 LVCHRRLHTGEKPYKCNECGKTFSEKSSLRCHRRLHTGEKPYKCNECGKTFGRNSALVIHKAIHT 364

  Fly   275 NERPFQCQHCDKAFTSTSTRQKHEMLHTNQRKYHCEICDQWFLRSSHLTLHQSTKLH 331
            .|:|::|..|.|.|:..|:.|.|.:|||.::.|.||.||..::|.|||..|:  |:|
Human   365 GEKPYKCNECGKTFSQKSSLQCHHILHTGEKPYKCEECDNVYIRRSHLERHR--KIH 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 19/83 (23%)
COG5048 <174..337 CDD:227381 56/162 (35%)
C2H2 Zn finger 197..217 CDD:275370 6/19 (32%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
zf-H2C2_2 268..290 CDD:290200 9/21 (43%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
C2H2 Zn finger 309..328 CDD:275368 9/18 (50%)
ZNF816NP_001026835.1 KRAB 24..64 CDD:307490 6/13 (46%)
C2H2 Zn finger 232..251 CDD:275368 0/18 (0%)
C2H2 Zn finger 259..279 CDD:275368 2/19 (11%)
COG5048 283..650 CDD:227381 54/139 (39%)
C2H2 Zn finger 287..307 CDD:275368 6/19 (32%)
C2H2 Zn finger 315..335 CDD:275368 5/19 (26%)
C2H2 Zn finger 343..363 CDD:275368 7/19 (37%)
C2H2 Zn finger 371..391 CDD:275368 7/19 (37%)
C2H2 Zn finger 399..419 CDD:275368 10/21 (48%)
C2H2 Zn finger 427..447 CDD:275368
C2H2 Zn finger 455..475 CDD:275368
C2H2 Zn finger 483..503 CDD:275368
C2H2 Zn finger 511..531 CDD:275368
C2H2 Zn finger 539..559 CDD:275368
C2H2 Zn finger 567..587 CDD:275368
C2H2 Zn finger 595..615 CDD:275368
C2H2 Zn finger 623..643 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.