DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and ERV3-1-ZNF117

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001334979.1 Gene:ERV3-1-ZNF117 / 109504726 -ID:- Length:483 Species:Homo sapiens


Alignment Length:411 Identity:101/411 - (24%)
Similarity:153/411 - (37%) Gaps:124/411 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CGKNVTNLQGRATKLFNK---SNYHFISILENITDMYLEFDTTLPHLICQCCK---------VQL 63
            |.|.|        ::|:|   ||.|.:...||            .|..|:.|:         .|.
Human    83 CNKYV--------EVFHKISNSNRHKMRHTEN------------KHFKCKECRKTFCMLSHLTQH 127

  Fly    64 DRILTFRN------------------------------KCLEVHKSFMAANRKLLRKKAIVDEEL 98
            .||.|..|                              ||.|..|:|...:. |:|.|.|..|| 
Human   128 KRIQTRVNFYKCEAYGRAFNWSSTLNKHKRIHTGEKPYKCKECGKAFNQTSH-LIRHKRIHTEE- 190

  Fly    99 DKP-----------DVEKLQQDLWDHTDQ-----EMCVAMADTAGLLREDH--NDNEKAKDAED- 144
             ||           ....|......||.:     |.||...:.|..|.|..  :..||..:.|: 
Human   191 -KPYKCEECGKAFNQSSTLTTHNIIHTGEIPYKCEKCVRAFNQASKLTEHKLIHTGEKRYECEEC 254

  Fly   145 --ATQNEKNQEEQVQVQTEE----VEHCQEQLHNMSIISKGVSARVPKRTKRNSKSWFCDQCGGV 203
              |........|...:.|.|    .|.|.:..:..|.::      ..||.....|.:.|::||..
Human   255 GKAFNRSSKLTEHKYIHTGEKLYKCEECGKAFNQSSTLT------THKRIHSGEKPYKCEECGKA 313

  Fly   204 FKSSTYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRHRILHTDARPYACRFCSKTYRGCSS--- 265
            ||..:.|..|.:.|:|.||:.|:.|...:...:.:.||:::||..:||.|..|.|.:...|:   
Human   314 FKQFSNLTDHKKIHTGEKPYKCEECGKAFNQLSNLTRHKVIHTGEKPYKCGECGKAFNQSSALNT 378

  Fly   266 -KVVH------------------------ERTHTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQR 305
             |::|                        ::.||.|:.::|:.|.|||..:||...|:.:||.::
Human   379 HKIIHTGENPHKCRESGKVFHLSSKLSTCKKIHTGEKLYKCEECGKAFNRSSTLIGHKRIHTGEK 443

  Fly   306 KYHCEICDQWFLRSSHLTLHQ 326
            .|.||.|.:.|.:||.||.|:
Human   444 PYKCEECGKAFNQSSTLTTHK 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 23/112 (21%)
COG5048 <174..337 CDD:227381 52/181 (29%)
C2H2 Zn finger 197..217 CDD:275370 7/19 (37%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
C2H2 Zn finger 253..273 CDD:275368 6/47 (13%)
zf-H2C2_2 268..290 CDD:290200 9/45 (20%)
C2H2 Zn finger 281..301 CDD:275368 8/19 (42%)
C2H2 Zn finger 309..328 CDD:275368 9/18 (50%)
ERV3-1-ZNF117NP_001334979.1 C2H2 Zn finger 111..131 CDD:275368 4/19 (21%)
C2H2 Zn finger 139..159 CDD:275368 0/19 (0%)
COG5048 163..>475 CDD:227381 83/311 (27%)
C2H2 Zn finger 167..187 CDD:275368 7/20 (35%)
C2H2 Zn finger 195..215 CDD:275368 1/19 (5%)
C2H2 Zn finger 223..243 CDD:275368 6/19 (32%)
C2H2 Zn finger 251..271 CDD:275368 3/19 (16%)
C2H2 Zn finger 279..299 CDD:275368 5/25 (20%)
C2H2 Zn finger 307..327 CDD:275368 7/19 (37%)
C2H2 Zn finger 335..355 CDD:275368 4/19 (21%)
C2H2 Zn finger 363..383 CDD:275368 5/19 (26%)
C2H2 Zn finger 391..407 CDD:275368 0/15 (0%)
C2H2 Zn finger 419..439 CDD:275368 8/19 (42%)
C2H2 Zn finger 447..467 CDD:275368 9/18 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.