DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and ZNF730

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_016881603.1 Gene:ZNF730 / 100129543 HGNCID:32470 Length:514 Species:Homo sapiens


Alignment Length:357 Identity:92/357 - (25%)
Similarity:143/357 - (40%) Gaps:73/357 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CGKNVTNLQGRATKLFNK---SNYHFISILENITDMYLEFDTTLPHLICQCCKV--------QLD 64
            |.|.|        |:|:|   ||.|.|           ...:..|....:|.|:        |..
Human   158 CDKYV--------KVFHKFSNSNRHKI-----------RHTSKKPFKCKECGKLFCILSHLAQHK 203

  Fly    65 RILTFRN--KCLEVHKSF-----MAANRKLLRKKAIVDEELDKPDVEKLQQDLW---------DH 113
            :|.|...  ||.|..|:|     ...::::..||....:|..|       ...|         .|
Human   204 KIHTGEKSYKCEEYGKAFNESSNCTTHKRITEKKPYKCKECGK-------AFNWFSHFTTHKRIH 261

  Fly   114 TDQ-----EMCVAMADTAGLL---REDHNDNE--KAKDAEDATQNEKNQEEQVQVQTEE----VE 164
            |.:     |.|....:.:..|   :..|...:  |.::...|.....|..|..::.|:|    .|
Human   262 TGEKPYQCEKCGKFFNQSTNLTTHKRIHTGEKPYKCEECGKAFNQSSNLTEHKKIHTKEQPYKCE 326

  Fly   165 HCQEQLHNMSIISKGVSARVPKRTKRNSKSWFCDQCGGVFKSSTYLKLHLQRHSGHKPFACDICQ 229
            .|.:.....|.::|      .||.....|.:.|::||..|..|:.|..|...|:|.||:....|.
Human   327 KCGKAFKWSSTLTK------HKRIHNGEKPYKCEECGKAFNRSSTLNRHKITHTGGKPYKYKECG 385

  Fly   230 AKYYTDNEMRRHRILHTDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDKAFTSTSTR 294
            ..:...:.:..|:|:||..:.|.|..|.|.:...|....|:|.||.|:|::|:.|.:||..:||.
Human   386 KAFNQSSTLTIHKIIHTVEKFYKCEECGKAFSRISHLTTHKRIHTGEKPYKCEECGRAFNQSSTL 450

  Fly   295 QKHEMLHTNQRKYHCEICDQWFLRSSHLTLHQ 326
            ..|:.:||.::.|.||.|.:.|.|||.||.|:
Human   451 TTHKRIHTGEKPYECEECGKAFNRSSTLTTHK 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 21/88 (24%)
COG5048 <174..337 CDD:227381 52/153 (34%)
C2H2 Zn finger 197..217 CDD:275370 7/19 (37%)
C2H2 Zn finger 225..245 CDD:275368 3/19 (16%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 268..290 CDD:290200 10/21 (48%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
C2H2 Zn finger 309..328 CDD:275368 10/18 (56%)
ZNF730XP_016881603.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.