DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31441 and Zfp984

DIOPT Version :9

Sequence 1:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001120661.1 Gene:Zfp984 / 100041677 MGIID:3651978 Length:547 Species:Mus musculus


Alignment Length:365 Identity:83/365 - (22%)
Similarity:146/365 - (40%) Gaps:68/365 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NVTNLQGRATKLFNKSN--YHFISILENIT------------DMYLEFDTTLPHLICQCCKVQLD 64
            |...|:.|.||...|.|  .:.:|:...|:            :...||:...         |...
Mouse   113 NQKRLKPRNTKEVCKYNDSVNSVSLFSTISLNQGIHLQKKKHNRNAEFEKVF---------VSKH 168

  Fly    65 RILTFRN-------KCLEVHKSFMAANRKLLR-------KKAIVDEELDKPDVEKL--------- 106
            :::..||       ||.|..| ::....||..       ||.....:.||....::         
Mouse   169 KVMVKRNNTGVNPYKCSEFDK-YLTQREKLQSQQRIYHGKKPYRSSKSDKCFTHQIHLSIHQGIH 232

  Fly   107 -QQDLWDHTDQEMCVAMADTAGLLREDHNDNEKAKDAE---------DATQNEKNQEEQVQVQTE 161
             ::.::..::.:.|........:.:..|......|.:|         ..:.:::....:...:..
Mouse   233 AEEKIYKCSECDKCFTHKSHLNIHQRIHTGENPYKCSECDKCFKHKFSFSMHQRIHTGEKPYKCS 297

  Fly   162 EVEHCQEQLHNMSIISKGVSARVPKRTKRNSKSWFCDQCGGVFKSSTYLKLHLQRHSGHKPFACD 226
            |.:.|..|..::|         |.:|.....|.:.|.:|...|...::|..|.:.|:|.||:.|.
Mouse   298 ECDKCFTQKSHLS---------VHQRIHTGEKPYKCSECDKCFTHKSHLNSHQRIHTGEKPYKCS 353

  Fly   227 ICQAKYYTDNEMRRHRILHTDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDKAFTST 291
            .|...:..:..:|.|:.:||...||.|..|.|.:...|:..:|:|.||.|:|::|..|||.||..
Mouse   354 ECDKCFTKNGSLRIHQRIHTGENPYKCSECDKCFTHKSNLNIHQRIHTGEKPYKCSECDKCFTHK 418

  Fly   292 STRQKHEMLHTNQRKYHCEICDQWFLRSSHLTLHQSTKLH 331
            |....|:.:||.::.|.|..||:.|.|..||::||  ::|
Mouse   419 SHLNSHQRIHTGEKPYKCSECDKCFTRKFHLSIHQ--RIH 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 18/88 (20%)
COG5048 <174..337 CDD:227381 52/158 (33%)
C2H2 Zn finger 197..217 CDD:275370 5/19 (26%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 268..290 CDD:290200 11/21 (52%)
C2H2 Zn finger 281..301 CDD:275368 8/19 (42%)
C2H2 Zn finger 309..328 CDD:275368 9/18 (50%)
Zfp984NP_001120661.1 KRAB 12..52 CDD:396083
C2H2 Zn finger 184..204 CDD:275368 5/20 (25%)
C2H2 Zn finger 216..232 CDD:275368 2/15 (13%)
COG5048 <220..465 CDD:227381 59/248 (24%)
C2H2 Zn finger 240..260 CDD:275368 1/19 (5%)
C2H2 Zn finger 268..288 CDD:275368 1/19 (5%)
C2H2 Zn finger 296..316 CDD:275368 6/28 (21%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
C2H2 Zn finger 352..372 CDD:275368 4/19 (21%)
C2H2 Zn finger 380..400 CDD:275368 6/19 (32%)
C2H2 Zn finger 408..428 CDD:275368 8/19 (42%)
C2H2 Zn finger 436..456 CDD:275368 9/21 (43%)
C2H2 Zn finger 464..484 CDD:275368
zf-H2C2_2 476..500 CDD:404364
C2H2 Zn finger 492..512 CDD:275368
zf-H2C2_2 504..529 CDD:404364
C2H2 Zn finger 520..540 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.