DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31431 and Flt1

DIOPT Version :10

Sequence 1:NP_732672.1 Gene:CG31431 / 326138 FlyBaseID:FBgn0051431 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_062179.2 Gene:Flt1 / 54251 RGDID:2621 Length:1336 Species:Rattus norvegicus


Alignment Length:243 Identity:50/243 - (20%)
Similarity:93/243 - (38%) Gaps:58/243 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GFDVKLQCNLKGLVDESMLNDIKIHWYFKQCSENNC--HQLGSVDEWTALPCEPSLCRPELWLRN 108
            |.|:||.|    :|.:.:..||.  |...:...|..  |.:......|......:|   .|.::|
  Rat   570 GEDLKLSC----VVSKFLYRDIT--WILLRTVNNRTMHHSISKQKMATTQDYSITL---NLVIKN 625

  Fly   109 VTERYSGLYKCSINPHIWDKAQAV--DVQLVRTYQLDVKNTSLAAPEFVDSYPNNKTTLVGSRVV 171
            |:...||.|.|        :|:.:  ..:::|..::.|::  |.||..:.:..:::.::.|| ..
  Rat   626 VSLEDSGTYAC--------RARNIYTGEEILRKTEVLVRD--LEAPLLLQNLSDHEVSISGS-TT 679

  Fly   172 FQCRVHSEEHPTIKWFRRQTYVGTQSGGEASSAPTTSNFSNHIVRYNGRTYELLSTDPEKMMAPQ 236
            ..|:......|.|.||:                      :||.::          .:|..::.|.
  Rat   680 LDCQARGVPAPQITWFK----------------------NNHKIQ----------QEPGIILGPG 712

  Fly   237 IYLSKLILDGVRLRDAGHYACVAISYRGHKIREAFLDVLADVEDTDQE 284
              .|.|.::.|...|.|.|.|.|.:.:|.....|:|.|....:.::.|
  Rat   713 --NSTLFIERVTEEDEGVYRCRATNQKGVVESSAYLTVQGTSDKSNLE 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31431NP_732672.1 Ig 152..272 CDD:472250 22/119 (18%)
Ig strand B 170..174 CDD:409353 0/3 (0%)
Ig strand C 183..187 CDD:409353 1/3 (33%)
Ig strand E 240..244 CDD:409353 2/3 (67%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 267..270 CDD:409353 0/2 (0%)
Flt1NP_062179.2 IG_like 143..219 CDD:214653
Ig 231..330 CDD:472250
Ig strand B 248..252 CDD:409353
Ig strand C 263..267 CDD:409353
Ig strand E 294..298 CDD:409353
Ig strand F 308..313 CDD:409353
Ig strand G 321..324 CDD:409353
Ig 333..424 CDD:472250
Ig strand B 353..357 CDD:409353
Ig strand C 366..370 CDD:409353
Ig strand E 388..392 CDD:409353
Ig strand F 402..407 CDD:409353
Ig strand G 417..420 CDD:409353
Ig 447..552 CDD:472250
Ig strand B 450..454 CDD:409353
Ig strand C 463..467 CDD:409353
Ig strand E 515..519 CDD:409353
Ig strand F 532..537 CDD:409353
Ig strand G 545..548 CDD:409353
IG_like 568..640 CDD:214653 21/86 (24%)
Ig strand B 573..577 CDD:409353 2/3 (67%)
Ig strand C 586..594 CDD:409353 3/9 (33%)
Ig strand E 619..623 CDD:409353 2/6 (33%)
Ig strand F 633..638 CDD:409353 2/12 (17%)
I-set 661..748 CDD:400151 23/121 (19%)
Ig strand B 679..682 CDD:409353 0/2 (0%)
Ig strand C 691..695 CDD:409353 1/3 (33%)
Ig strand E 714..718 CDD:409353 2/3 (67%)
Ig strand F 728..733 CDD:409353 2/4 (50%)
Protein Kinases, catalytic domain 819..1157 CDD:473864
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.