DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31431 and fgfrl1b

DIOPT Version :9

Sequence 1:NP_001247231.1 Gene:CG31431 / 326138 FlyBaseID:FBgn0051431 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001012263.2 Gene:fgfrl1b / 497135 ZFINID:ZDB-GENE-050201-3 Length:481 Species:Danio rerio


Alignment Length:238 Identity:62/238 - (26%)
Similarity:102/238 - (42%) Gaps:40/238 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LIQQRAGFDVKLQCNLKGLVDESMLNDIKIHWYFKQCSENNCHQLGSVDEWTALPCEPSLCRPEL 104
            :::|..|..|:|:|...|       |...:..::|..|..:..|.....:||            |
Zfish   160 VLEQPVGSSVRLKCLASG-------NPTPVITWWKDQSLLDNPQQSKRPQWT------------L 205

  Fly   105 WLRNVTERYSGLYKCSINPHIWDKAQAVDVQLVRTYQLDVKNTSLAAPEFVDSYPNNKTTLVGSR 169
            .|:|:..:.|..|.|    |:.:.|..::.    ||::||...:.:.|....::|.|.|...|..
Zfish   206 TLKNLQPQDSAKYTC----HVSNAAGHINA----TYKVDVIERTNSKPILTGTHPVNTTVEFGGT 262

  Fly   170 VVFQCRVHSEEHPTIKWFRRQTYVGTQSGGEASSAPTTSNFSNHIVRYNGRTYELLSTDPEKMMA 234
            ..|||:|||:..|.|:|.:|..             |.:.:..|..:...|:.|.:|.|.......
Zfish   263 ASFQCKVHSDVKPVIQWLKRVD-------------PGSEDRYNSTLEVGGQHYVVLPTGDVWSRP 314

  Fly   235 PQIYLSKLILDGVRLRDAGHYACVAISYRGHKIREAFLDVLAD 277
            ...||:||.:...|..|||.|.|:..:..|:.:|.|:|.||:|
Zfish   315 DGSYLNKLAIVKARDEDAGMYICLGANTMGYSVRSAYLTVLSD 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31431NP_001247231.1 IG_like 159..274 CDD:214653 34/114 (30%)
Ig 167..275 CDD:299845 31/107 (29%)
fgfrl1bNP_001012263.2 I-set 26..113 CDD:254352
IGc2 43..103 CDD:197706
Ig2_FGFRL1-like 158..237 CDD:143264 22/103 (21%)
IG_like 165..237 CDD:214653 21/98 (21%)
IG_like 252..354 CDD:214653 34/114 (30%)
Ig 260..355 CDD:299845 31/107 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576016
Domainoid 1 1.000 49 1.000 Domainoid score I11815
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19890
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.