DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31431 and fgfrl1

DIOPT Version :9

Sequence 1:NP_001247231.1 Gene:CG31431 / 326138 FlyBaseID:FBgn0051431 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001011189.1 Gene:fgfrl1 / 496611 XenbaseID:XB-GENE-482472 Length:484 Species:Xenopus tropicalis


Alignment Length:246 Identity:62/246 - (25%)
Similarity:98/246 - (39%) Gaps:54/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LIQQRAGFDVKLQCNLKG--------LVDESMLNDIKIHWYFKQCSENNCHQLGSVDEWTALPCE 96
            :|.:..|..|:|:|...|        |.|...|..       ::..:|      ...:||     
 Frog   153 VIARPVGSSVRLKCIASGNPRPDITWLKDNKPLTS-------QEIGDN------KKKKWT----- 199

  Fly    97 PSLCRPELWLRNVTERYSGLYKCSINPHIWDKAQAVDVQLVRTYQLDVKNTSLAAPEFVDSYPNN 161
                   |.|:::....||.|.|.:...:.        |:..||:::|...:.:.|....::|.|
 Frog   200 -------LNLKSLKPEDSGKYTCQVYNRVG--------QINATYKVEVIQRTRSKPILTGNHPVN 249

  Fly   162 KTTLVGSRVVFQCRVHSEEHPTIKWFRRQTYVGTQSGGEASSAPTTSNFSNHIVRYNGRTYELLS 226
            .|...|....|||:|.|:..|.|:|.:|..| ||:            |..|..:...|:.:.:|.
 Frog   250 TTVDFGGTTSFQCKVRSDVKPVIQWLKRVEY-GTE------------NKYNSTIDVGGQKFIVLP 301

  Fly   227 TDPEKMMAPQIYLSKLILDGVRLRDAGHYACVAISYRGHKIREAFLDVLAD 277
            |..........||:|||:...|..|||.|.|:..:..|:..:.|||.||.|
 Frog   302 TGEVWSRPDGSYLNKLIITRAREEDAGMYICLGANTMGYSFKSAFLTVLPD 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31431NP_001247231.1 IG_like 159..274 CDD:214653 36/114 (32%)
Ig 167..275 CDD:299845 33/107 (31%)
fgfrl1NP_001011189.1 I-set 23..110 CDD:369462
Ig2_FGFRL1-like 151..232 CDD:143264 21/111 (19%)
Ig 255..349 CDD:386229 33/106 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11580
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19890
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.