DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31431 and FGFR2

DIOPT Version :10

Sequence 1:NP_732672.1 Gene:CG31431 / 326138 FlyBaseID:FBgn0051431 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_075259.4 Gene:FGFR2 / 2263 HGNCID:3689 Length:822 Species:Homo sapiens


Alignment Length:281 Identity:70/281 - (24%)
Similarity:104/281 - (37%) Gaps:82/281 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YTENTELIQQR-----AGFDVKLQCNLKGLVDESMLNDIKIHWY-----FKQCSENNCHQLGSV- 87
            |..|||.:::|     |...||.:|...|....:|      .|.     |||     .|::|.. 
Human   155 YWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTM------RWLKNGKEFKQ-----EHRIGGYK 208

  Fly    88 ---DEWTALPCEPSLCRPELWLRNVTERYSGLYKC-------SINPHIWDKAQAVDVQLVRTYQL 142
               ..|:            |.:.:|.....|.|.|       |||               .||.|
Human   209 VRNQHWS------------LIMESVVPSDKGNYTCVVENEYGSIN---------------HTYHL 246

  Fly   143 DVKNTSLAAPEFVDSYPNNKTTLVGSRVVFQCRVHSEEHPTIKWFRRQTYVGTQSGGEASSAPTT 207
            ||...|...|......|.|.:|:||..|.|.|:|:|:..|.|:|.:.....|::.|.:  ..|..
Human   247 DVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPD--GLPYL 309

  Fly   208 SNFSNHIVRYNGRTYELLSTDPEKMMAPQIYLSKLILDGVRLRDAGHYACVAISYRGHKIREAFL 272
            .     :::::|    :.|::.|          .|.|..|...|||.|.|...:|.|...:.|:|
Human   310 K-----VLKHSG----INSSNAE----------VLALFNVTEADAGEYICKVSNYIGQANQSAWL 355

  Fly   273 DVLADVEDTDQENEYWS--DY 291
            .||...:...:|.|..:  ||
Human   356 TVLPKQQAPGREKEITASPDY 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31431NP_732672.1 Ig 152..272 CDD:472250 31/119 (26%)
Ig strand B 170..174 CDD:409353 2/3 (67%)
Ig strand C 183..187 CDD:409353 1/3 (33%)
Ig strand E 240..244 CDD:409353 1/3 (33%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 267..270 CDD:409353 0/2 (0%)
FGFR2NP_075259.4 IgI_1_FGFR 31..124 CDD:409362
Ig strand A 31..34 CDD:409362
Ig strand A' 47..53 CDD:409362
Ig strand B 56..66 CDD:409362
Ig strand C 69..74 CDD:409362
Ig strand C' 77..79 CDD:409362
Ig strand D 84..88 CDD:409362
Ig strand E 91..96 CDD:409362
Ig strand F 102..111 CDD:409362
Ig strand G 114..124 CDD:409362
IgI_2_FGFR 154..248 CDD:409443 29/130 (22%)
Ig strand A 154..157 CDD:409443 1/1 (100%)
Ig strand A' 165..170 CDD:409443 1/4 (25%)
Ig strand B 174..182 CDD:409443 3/7 (43%)
Ig strand C 188..193 CDD:409443 2/10 (20%)
Ig strand C' 196..198 CDD:409443 0/1 (0%)
Ig strand D 207..210 CDD:409443 0/2 (0%)
Ig strand E 214..219 CDD:409443 2/16 (13%)
Ig strand F 228..235 CDD:409443 2/6 (33%)
Ig strand G 238..248 CDD:409443 6/24 (25%)
Ig 256..358 CDD:472250 32/122 (26%)
Ig strand B 274..278 CDD:409353 2/3 (67%)
Ig strand C 287..291 CDD:409353 1/3 (33%)
Ig strand E 323..327 CDD:409353 2/13 (15%)
Ig strand F 337..342 CDD:409353 2/4 (50%)
Ig strand G 350..353 CDD:409353 0/2 (0%)
PTKc_FGFR2 457..769 CDD:270679
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.