DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31431 and Fgfrl1

DIOPT Version :9

Sequence 1:NP_001247231.1 Gene:CG31431 / 326138 FlyBaseID:FBgn0051431 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_473412.1 Gene:Fgfrl1 / 116701 MGIID:2150920 Length:529 Species:Mus musculus


Alignment Length:335 Identity:80/335 - (23%)
Similarity:128/335 - (38%) Gaps:86/335 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LIQQRAGFDVKLQCNLKG--------LVDESMLNDIKIHWYFKQCSENNCHQLGSVDEWTALPCE 96
            :|.:..|..|:|:|...|        :.|:..|..::...:.|:             :||     
Mouse   155 VIARPVGSSVRLKCVASGHPRPDIMWMKDDQTLTHLEASEHRKK-------------KWT----- 201

  Fly    97 PSLCRPELWLRNVTERYSGLYKCSINPHIWDKAQAVDVQLVRTYQLDVKNTSLAAPEFVDSYPNN 161
                   |.|:|:....||.|.|.::    :||.|::.    ||::||...:.:.|....::|.|
Mouse   202 -------LSLKNLKPEDSGKYTCRVS----NKAGAINA----TYKVDVIQRTRSKPVLTGTHPVN 251

  Fly   162 KTTLVGSRVVFQCRVHSEEHPTIKWFRRQTYVGTQSGGEASSAPTTSNFSNHIVRYNGRTYELLS 226
            .|...|....|||:|.|:..|.|:|.:|..|     |.|..        .|..:...|:.:.:|.
Mouse   252 TTVDFGGTTSFQCKVRSDVKPVIQWLKRVEY-----GSEGR--------HNSTIDVGGQKFVVLP 303

  Fly   227 TDPEKMMAPQIYLSKLILDGVRLRDAGHYACVAISYRGHKIREAFLDVLADVEDTDQENEYWSDY 291
            |..........||:||::...|..|||.|.|:..:..|:..|.|||.||.|              
Mouse   304 TGDVWSRPDGSYLNKLLISRARQDDAGMYICLGANTMGYSFRSAFLTVLPD-------------- 354

  Fly   292 GNEDEGVP-----TSDRREFLLLFLMPLGLALLPLTV--WFSYLLYKRCS-------VGH---GD 339
             .:..|.|     :|....:.::..:|.|...:..||  |......|.|:       .||   |.
Mouse   355 -PKPPGPPMASSSSSTSLPWPVVIGIPAGAVFILGTVLLWLCQTKKKPCAPASTLPVPGHRPPGT 418

  Fly   340 CQRIDSDEDL 349
            .:....|:||
Mouse   419 SRERSGDKDL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31431NP_001247231.1 IG_like 159..274 CDD:214653 35/114 (31%)
Ig 167..275 CDD:299845 32/107 (30%)
Fgfrl1NP_473412.1 I-set 29..112 CDD:369462
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..151
Ig2_FGFRL1-like 153..234 CDD:143264 23/111 (21%)
Ig 257..351 CDD:386229 32/106 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..427 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833323
Domainoid 1 1.000 47 1.000 Domainoid score I11989
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7169
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19890
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.