DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2e and Npc2h

DIOPT Version :9

Sequence 1:NP_731439.2 Gene:Npc2e / 326136 FlyBaseID:FBgn0051410 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001247376.1 Gene:Npc2h / 43649 FlyBaseID:FBgn0039801 Length:157 Species:Drosophila melanogaster


Alignment Length:164 Identity:37/164 - (22%)
Similarity:63/164 - (38%) Gaps:25/164 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLR----IVVTLALILATVNA--TNVQQCKNKPFPLD------VNIKDCEE----PPCVVYKGTI 49
            |||    :.|..||:|::|:|  .|.|.|::.   :|      |.:..|.|    ..|.:.:...
  Fly     1 MLRLSSLLPVAFALVLSSVSAEIVNFQTCEDS---VDSCSISQVRVTPCPEANANAACHIRRRHR 62

  Fly    50 AVMEVHFLGNNNNIKSITATTTAKVLGMNLPYALPDEVSDVCRNLLYGAICPIDKDEDVTYQFNF 114
            ..|...|..:.:....:.:...||...:.||....|:  :.|:.    ..||:......||..|.
  Fly    63 FTMSFDFTPHFDADTLVASLGWAKSENVELPLLTMDQ--EACKY----TTCPVRSGVTQTYTNNM 121

  Fly   115 YVEPSFPEITADVTVTLNDAQNEPITCFVVSCKI 148
            ..:..||.....:...|.|..::...||.:..|:
  Fly   122 PADARFPLSPYTIRWALKDPVSQKRCCFTIDIKV 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2eNP_731439.2 ML 20..144 CDD:294195 26/133 (20%)
Npc2hNP_001247376.1 Npc2_like 26..153 CDD:238458 26/135 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.