DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2e and Npc2g

DIOPT Version :9

Sequence 1:NP_731439.2 Gene:Npc2e / 326136 FlyBaseID:FBgn0051410 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001247375.1 Gene:Npc2g / 43648 FlyBaseID:FBgn0039800 Length:159 Species:Drosophila melanogaster


Alignment Length:157 Identity:34/157 - (21%)
Similarity:56/157 - (35%) Gaps:23/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VTLALIL----ATVNATNVQQCKNKPFPLD------VNIKDCEE----PPCVVYKGTIAVMEVHF 56
            |.:|::|    |:....|.:.|   |..:|      |.:..|.|    ..|.:.:...:.|...|
  Fly    10 VAIAIVLISSSASAEVVNFEPC---PDSVDTCTIQQVRVSPCPEALNNAACNIRRKHNSEMSFDF 71

  Fly    57 LGNNNNIKSITATTTAKVLGMNLPYALPDEVSDVCRNLLYGAICPIDKDEDVTYQFNFYVEPSFP 121
            ..|.:....:.:...||...:.||....|  |..|:.    ..||:......||.....:|..||
  Fly    72 TPNFDADTLVASLGWAKSENVELPLLTLD--SAACKY----TPCPVRSGVKQTYTTLVPIEAKFP 130

  Fly   122 EITADVTVTLNDAQNEPITCFVVSCKI 148
            .....:...|.|..::...||.:..|:
  Fly   131 LSPYTIRWALKDPVSQKRCCFTIDIKV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2eNP_731439.2 ML 20..144 CDD:294195 28/133 (21%)
Npc2gNP_001247375.1 Npc2_like 28..155 CDD:238458 28/135 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451270
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.