DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2e and Npc2c

DIOPT Version :9

Sequence 1:NP_731439.2 Gene:Npc2e / 326136 FlyBaseID:FBgn0051410 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_649976.1 Gene:Npc2c / 41233 FlyBaseID:FBgn0037783 Length:165 Species:Drosophila melanogaster


Alignment Length:158 Identity:56/158 - (35%)
Similarity:91/158 - (57%) Gaps:9/158 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VTLALIL-----ATVNATNVQQC--KNKPFPLDVNIKDCEEPPCVVYKGTIAVMEVHFLGNNNNI 63
            ::|.|:|     :..::|.::||  .|.|.||.|.|.||:..||.::|||.|.:::.|:...|.:
  Fly     7 LSLCLVLSIMWTSVADSTPIRQCADSNYPQPLMVQIDDCDALPCDLWKGTEAKIDIQFVATRNTM 71

  Fly    64 KSITATTTAKVLGMNLPYALPDEVSDVCRNLLYGAICPIDKDEDVTYQFNFYVEPSFPEITADVT 128
            |.::|......||:.:||.|.....:||.|||:||.||:|..||||||....|..:.||:...:.
  Fly    72 KKLSAEVHLTSLGVTIPYDLEASRGNVCSNLLHGAYCPLDAGEDVTYQLLLPVTTNQPEVPTRLE 136

  Fly   129 VTL--NDAQNEPITCFVVSCKIRKGATA 154
            |.|  :|.:|..::||:...:::|..:|
  Fly   137 VRLLDSDDENRVVSCFLADTRVKKPRSA 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2eNP_731439.2 ML 20..144 CDD:294195 50/127 (39%)
Npc2cNP_649976.1 Npc2_like 26..155 CDD:238458 50/128 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469000
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25884
OrthoDB 1 1.010 - - D110250at33392
OrthoFinder 1 1.000 - - FOG0003275
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6488
87.860

Return to query results.
Submit another query.