DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2e and Npc2d

DIOPT Version :9

Sequence 1:NP_731439.2 Gene:Npc2e / 326136 FlyBaseID:FBgn0051410 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_649975.1 Gene:Npc2d / 41232 FlyBaseID:FBgn0037782 Length:173 Species:Drosophila melanogaster


Alignment Length:174 Identity:68/174 - (39%)
Similarity:97/174 - (55%) Gaps:18/174 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVVTLALILATVN------ATNVQQCK-NKPFPLDVNIKDCEEPPCVVYKGTIAVMEVHFLGNNN 61
            ::::|.|:|:...      ||:|::|. :|||||:|.:.:|..|||.:.|||....|:.|..:  
  Fly     7 VLISLGLLLSLAEAQQEHPATSVKKCSGSKPFPLEVRVHNCVTPPCQIVKGTTQKFEIDFAVD-- 69

  Fly    62 NIKSITATTT---AKVLG-MNLPYALPDEVSDVCRNLLYGAICPIDKDEDVTYQFNFYVEPSFPE 122
              |.||..||   |..|| :.:||.||.:|:.||.||.|||.||:...|||:|.|.|.: ..:||
  Fly    70 --KYITQLTTLVKATTLGIITVPYELPADVAAVCPNLQYGAYCPLYPTEDVSYLFTFPI-GEYPE 131

  Fly   123 ITADVTVTLNDAQNEPITCFVVSCKIRKGATAAQMDGYLLDWTN 166
            |...:.:.|.|..||..||||...|:.||.....:  |.||:.|
  Fly   132 IGVKIEIYLVDQDNEIATCFVCDIKVVKGNGGNTV--YELDYLN 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2eNP_731439.2 ML 20..144 CDD:294195 55/128 (43%)
Npc2dNP_649975.1 Npc2_like 29..155 CDD:238458 56/130 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469001
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25884
OrthoDB 1 1.010 - - D110250at33392
OrthoFinder 1 1.000 - - FOG0003275
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.