DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2e and npc2.1

DIOPT Version :9

Sequence 1:NP_731439.2 Gene:Npc2e / 326136 FlyBaseID:FBgn0051410 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_775331.1 Gene:npc2.1 / 282673 ZFINID:ZDB-GENE-021206-13 Length:149 Species:Danio rerio


Alignment Length:114 Identity:30/114 - (26%)
Similarity:54/114 - (47%) Gaps:10/114 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LDVNIKDCEEPPCVVYKGTIAVMEVHFLGNNNNIKSIT--ATTTAKVLGMNLPYALPDEVSDVCR 92
            :.|:||.|.:.||.::||....:.|.|   ::.::|.|  |.....:.|:.:|:.:|  :.|.|:
Zfish    35 VQVDIKPCSQQPCKLHKGQSYTVNVTF---SSGVESQTSKAVVHGVLAGVPVPFPIP--IDDGCK 94

  Fly    93 NLLYGAICPIDKDEDVTYQFNFYVEPSFPEITADVTVTLNDAQNEPITC 141
            :   |..|||...:...|.....|:..:|.|...|...|.|..::.:.|
Zfish    95 S---GIQCPIVPQKPYNYVTELPVKTEYPAIKVVVEWELRDDSSKDLFC 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2eNP_731439.2 ML 20..144 CDD:294195 30/114 (26%)
npc2.1NP_775331.1 Npc2_like 24..145 CDD:238458 30/114 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.