DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31343 and pip4k2a

DIOPT Version :9

Sequence 1:NP_732652.1 Gene:CG31343 / 326133 FlyBaseID:FBgn0051343 Length:961 Species:Drosophila melanogaster
Sequence 2:NP_001123723.1 Gene:pip4k2a / 100170468 XenbaseID:XB-GENE-962635 Length:405 Species:Xenopus tropicalis


Alignment Length:258 Identity:57/258 - (22%)
Similarity:87/258 - (33%) Gaps:85/258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   695 RLIDPIFDKI--GVNEIPGEHYLNNYLRIVLVSLACQVGSDDCYNQSANKLSEYLYNGTAIEATL 757
            |..||:...:  |||     |.:|   .:..|.:...:..||....|..|:..:|:|...:.:..
 Frog    31 RASDPLLSVLMWGVN-----HSIN---ELSHVQIPIMLMPDDFKAYSKIKVDNHLFNKENMPSHF 87

  Fly   758 KTQAYCAGLRSTTNEIYSRVQSDLLSS--------SDSTDRS----------------------- 791
            |.:.||..:.....|.:.....|.|:|        :||..||                       
 Frog    88 KFKEYCPMVFRNLRERFGIDDQDFLNSLTRYSPLANDSQARSGARFHTSCDKRYIIKTITSEDVA 152

  Fly   792 ----------LFISSLGCSGST--SQLLDFLRLSLD--------TNNSLSYSERTSLLNSAYSRS 836
                      .||  :.|.|:|  .|.|...||::|        |.|  .:|.|.|:    |.:.
 Frog   153 EMHNILKKYHQFI--VECHGNTLLPQFLGMYRLNVDGVETYMIVTRN--VFSHRLSV----YRKY 209

  Fly   837 EI-GLTASLEFLESNWEAYANLSDSAKPL------DAALRGIATYVVSEKQKTRLNALVDVVE 892
            :: |.|.:.|         |:..:.||.|      |....|...|:....:|..|..|...||
 Frog   210 DLKGSTVARE---------ASDKEKAKELPTYKDNDFINDGQKIYIDENNKKLFLEKLKKDVE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31343NP_732652.1 Peptidase_M1 57..446 CDD:279741
M1_APN_2 65..517 CDD:189008
ERAP1_C 591..886 CDD:288671 54/250 (22%)
pip4k2aNP_001123723.1 PIPKc_PIP5K2A 26..402 CDD:340446 57/258 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165173333
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.