Sequence 1: | NP_732652.1 | Gene: | CG31343 / 326133 | FlyBaseID: | FBgn0051343 | Length: | 961 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001123723.1 | Gene: | pip4k2a / 100170468 | XenbaseID: | XB-GENE-962635 | Length: | 405 | Species: | Xenopus tropicalis |
Alignment Length: | 258 | Identity: | 57/258 - (22%) |
---|---|---|---|
Similarity: | 87/258 - (33%) | Gaps: | 85/258 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 695 RLIDPIFDKI--GVNEIPGEHYLNNYLRIVLVSLACQVGSDDCYNQSANKLSEYLYNGTAIEATL 757
Fly 758 KTQAYCAGLRSTTNEIYSRVQSDLLSS--------SDSTDRS----------------------- 791
Fly 792 ----------LFISSLGCSGST--SQLLDFLRLSLD--------TNNSLSYSERTSLLNSAYSRS 836
Fly 837 EI-GLTASLEFLESNWEAYANLSDSAKPL------DAALRGIATYVVSEKQKTRLNALVDVVE 892 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31343 | NP_732652.1 | Peptidase_M1 | 57..446 | CDD:279741 | |
M1_APN_2 | 65..517 | CDD:189008 | |||
ERAP1_C | 591..886 | CDD:288671 | 54/250 (22%) | ||
pip4k2a | NP_001123723.1 | PIPKc_PIP5K2A | 26..402 | CDD:340446 | 57/258 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165173333 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |